DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4465 and SLC22A11

DIOPT Version :9

Sequence 1:NP_650847.1 Gene:CG4465 / 42374 FlyBaseID:FBgn0038750 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_060954.1 Gene:SLC22A11 / 55867 HGNCID:18120 Length:550 Species:Homo sapiens


Alignment Length:426 Identity:106/426 - (24%)
Similarity:167/426 - (39%) Gaps:77/426 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 SLTMEFDLVCLCDFFVAWSQYWHLFGLLIGGVAATKLMRVLSPRQIYRTG-----IWCLLMCSLL 213
            ::..::||||........||...:.|:|:|..    :..:||    ||.|     .||.|..: :
Human   127 TIVAKWDLVCSSQGLKPLSQSIFMSGILVGSF----IWGLLS----YRFGRKPMLSWCCLQLA-V 182

  Fly   214 MG----LVKDFSLHCGLRCLAAVSCCFMITSGQYIFGDITAGKYRVGTLILYDCFWALGLILLPG 274
            .|    ....|.::||||.:||.....:..|...:..:.|....|..|:.:..|.::.|...|.|
Human   183 AGTSTIFAPTFVIYCGLRFVAAFGMAGIFLSSLTLMVEWTTTSRRAVTMTVVGCAFSAGQAALGG 247

  Fly   275 LASNAPSWQHIYLGVTLSLLVIVFLLPWTPDSPRWQLQHTKEAQLAIERTVGILLEAARTNGRMH 339
            ||.....|:.:.|..::....|..:..|.|:|.||.:...|..|...|     |.:.||.||  |
Human   248 LAFALRDWRTLQLAASVPFFAISLISWWLPESARWLIIKGKPDQALQE-----LRKVARING--H 305

  Fly   340 KVSKELPQQ--LEELRERML---EP--------MPAVHWMHLWMGQRRSTFHLVAVHMALATFMV 391
            |.:|.|..:  :..::|.:.   ||        :|.:.|        ||...||.....|.::. 
Human   306 KEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPVLRW--------RSCAMLVVNFSLLISYY- 361

  Fly   392 VNTGLLLHVRSFGREHLVSNTLAMGLAEMLG-CFLALHLTFNLSERKWQWAG-----GFAIVVGC 450
               ||:..::|.||:..:...| .|..:.|| ...||.|:| |..|..| ||     |.||:.. 
Human   362 ---GLVFDLQSLGRDIFLLQAL-FGAVDFLGRATTALLLSF-LGRRTIQ-AGSQAMAGLAILAN- 419

  Fly   451 IGSICWFLAEEDMPEVYGLTLGLLMASLPQAAVACAQSMILACLGELVPMEQRSCLSFSAVTWAR 515
                  .|..:|:.     ||.::.|.|.:.....:.:.:.....||.|...|........|..|
Human   420 ------MLVPQDLQ-----TLRVVFAVLGKGCFGISLTCLTIYKAELFPTPVRMTADGILHTVGR 473

  Fly   516 VWQLSASFLTLLRQVSPALS------LSAFCLLVIL 545
            :..:....:.:.||..|.|.      :|....||:|
Human   474 LGAMMGPLILMSRQALPLLPPLLYGVISIASSLVVL 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4465NP_650847.1 2A0119 67..553 CDD:273328 106/426 (25%)
MFS 169..>303 CDD:119392 34/142 (24%)
SLC22A11NP_060954.1 Sugar_tr 11..523 CDD:331684 106/426 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153208
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.