DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4465 and CG6356

DIOPT Version :10

Sequence 1:NP_650847.1 Gene:CG4465 / 42374 FlyBaseID:FBgn0038750 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_651240.1 Gene:CG6356 / 42893 FlyBaseID:FBgn0039178 Length:570 Species:Drosophila melanogaster


Alignment Length:232 Identity:50/232 - (21%)
Similarity:93/232 - (40%) Gaps:68/232 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KELSDNDDLATGLVLDTILGFQTHKMSLKYRPLKANKDEIKNIIEEFIRTQNYGKCYQQLMNGNW 108
            |.:|:..||:..|| ||   ..|::|:|.||.|    :||...|.: .:::|...|         
  Fly   712 KMISNQIDLSVVLV-DT---GNTYQMNLNYRKL----NEISTSITD-DQSKNAMNC--------- 758

  Fly   109 MPRSVLNKNKLALKRLEAHIYRYLRVFDQHSGFVIEACYRYSLEGQKGAKICSTRRWMKNEKIEC 173
                 .|.:::|:....:..:....|..:..|.:  |.:|        |::...|:.||      
  Fly   759 -----TNVSEIAIVVYVSWAFLQAGVEPESIGII--APFR--------AQVELIRKLMK------ 802

  Fly   174 LVGCIAELTEREEADLLYPGRNDFSVMYSCRKNCAQLWLGPAAYINHDCRANCKFV--ATGRDT- 235
                  :|.|:::. ..:...::.:|:|: ::|..||        ||.|......:  ..|:|. 
  Fly   803 ------KLFEKQKY-TRHSSSSNHNVIYT-KENVEQL--------NHTCNIEVNTIDQFQGKDKK 851

  Fly   236 ----ACVKV--LRD---IEVGEEITCFYGEDFFGDNN 263
                :|.|.  |.|   |..|:|.:. :|.:...|.:
  Fly   852 IILFSCTKSSNLSDDIWINKGKERSS-HGYEILSDKS 887

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4465NP_650847.1 MFS_SLC22 143..553 CDD:340875 27/133 (20%)
CG6356NP_651240.1 MFS_SLC22 140..544 CDD:340875
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.