DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4465 and Slc22a17

DIOPT Version :9

Sequence 1:NP_650847.1 Gene:CG4465 / 42374 FlyBaseID:FBgn0038750 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_803156.2 Gene:Slc22a17 / 305886 RGDID:631405 Length:520 Species:Rattus norvegicus


Alignment Length:481 Identity:112/481 - (23%)
Similarity:172/481 - (35%) Gaps:152/481 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 PDVNSTVSLDHCYVMVNYGESAYAMRQCRKFLYTTGFHSLTM----EFDLVCLCDFFVAWSQYWH 176
            ||.|      ||....:|                .|...||.    ::||||...:.|...|.  
  Rat    65 PDFN------HCLKDWDY----------------NGLPVLTTNAIGQWDLVCDLGWQVILEQI-- 105

  Fly   177 LFGLLIGGVAATKLMRVLSPRQIYRTGIWCLLMCSLLMGLVKDFSLHCGLRCLAAVSCCFMITSG 241
               |.|.|.|:..|.......:..|.||     ..|.:|||..    ||:...||.|...::|. 
  Rat   106 ---LFILGFASGYLFLGYPADRFGRRGI-----VLLTLGLVGP----CGVGGAAAGSSTGIMTL- 157

  Fly   242 QYIFGDITAG---------------KYRVGTLILYDCFWALGLILLPGLASNAPSWQHIYLGVTL 291
            :::.|.:.||               ..|:...:..:.....|..|..|||..:..|:.:...:|.
  Rat   158 RFLLGFLLAGVDLGVYLMRLELCDPTQRLRVALAGELVGVGGHFLFLGLALVSKDWRFLQRMITA 222

  Fly   292 SLLVIVFLLPWTP---DSPRWQL--QHTKEAQLAIERTVGILLEAARTNGRMHKVSKELPQQLEE 351
            ..::.:| ..|..   :|.||.:  :..:|||..:.    ||.|..|.:|:|  :.:|..:.|:|
  Rat   223 PCILFLF-YGWPGLFLESARWLIVKRQIEEAQSVLR----ILAERNRPHGQM--LGEEAQEALQE 280

  Fly   352 LRERMLEPMPA---------VHWMHLWM------------------------GQRRSTFHLVAVH 383
            |....  |:|.         :::.::|.                        |...|.|:|.:: 
  Rat   281 LENTC--PLPTTSTFSFASLLNYRNIWKNLLILGFTNFIAHAIRHCYQPVGGGGSPSDFYLCSL- 342

  Fly   384 MALATFMVVNTGLLLHVRSFGREH--LVSNTLAMGLAEMLGCFLALHLTFNLSERKWQWAGGFAI 446
            :|..|..:....|.:.|..|||..  |:|.||. |:|.::  .|.|          |.:....||
  Rat   343 LASGTAALACVFLGVTVDRFGRRGILLLSMTLT-GIASLV--LLGL----------WDYLNDAAI 394

  Fly   447 ----VVGCIGS-----ICWFLAEEDMP-EVYGLTLGLLMA-------SLPQ-------------- 480
                |:|...|     :...||.|.:| .|.|..|||:||       |.|.              
  Rat   395 TTFSVLGLFSSQASAILSTLLAAEVIPTTVRGRGLGLIMALGALGGLSCPAQRLHMGHGAFLQHV 459

  Fly   481 AAVACAQSMILACLGELVPMEQRSCL 506
            ...|||...||:.:  |:|..:|..|
  Rat   460 VLAACALLCILSIM--LLPETKRKLL 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4465NP_650847.1 2A0119 67..553 CDD:273328 112/481 (23%)
MFS 169..>303 CDD:119392 32/148 (22%)
Slc22a17NP_803156.2 MFS 106..476 CDD:119392 94/404 (23%)
2A0114 111..475 CDD:273326 90/398 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.