DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4465 and Slc22a5

DIOPT Version :9

Sequence 1:NP_650847.1 Gene:CG4465 / 42374 FlyBaseID:FBgn0038750 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_062142.1 Gene:Slc22a5 / 29726 RGDID:3702 Length:557 Species:Rattus norvegicus


Alignment Length:558 Identity:113/558 - (20%)
Similarity:213/558 - (38%) Gaps:129/558 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DDDVITHIMGNFGPWQLRSLLILFLCKIPAAWFMACILFTAPDLYPEEEYKCDTTAFGPDVNSTV 122
            |.|.:|..:|.:||:|.....:|....||..:....|:|.|    ...|::|       .|..||
  Rat     3 DYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFNGMSIVFLA----GTPEHRC-------LVPHTV 56

  Fly   123 SLDHCY----VMVNYGESAYAMRQCRKFLYTT--GFHSLTM------------------------ 157
            :|...:    :.:...:.....:.||::...|  .|.:|.:                        
  Rat    57 NLSSAWRNHSIPLETKDGRQVPQSCRRYRLATIANFSALGLEPGRDVDLEQLEQENCLDGWEYNK 121

  Fly   158 ---------EFDLVCLCDFFVAWSQYWHLFGLLIGGVAATKLMRVLSPRQIYRTGIWCLLMCSLL 213
                     |:||||..|:....:......|:|:|...:.:|......:.:          ..|.
  Rat   122 DVFLSTIVTEWDLVCKDDWKAPLTTSLFFVGVLMGSFISGQLSDRFGRKNV----------LFLT 176

  Fly   214 MGLVKDFSLHCGLRCLAAVSCCF--------MITSGQ-------YIFG-DITAGKYRVGTLILYD 262
            ||:...||.      |...|..|        ::..||       ::.| :|.:...|:....|..
  Rat   177 MGMQTGFSF------LQLFSVNFEMFTVLFVLVGMGQISNYVAAFVLGTEILSKSIRIIFATLGV 235

  Fly   263 C-FWALGLILLPGLASNAPSWQHIYLGVTLSLLVIVFLLPWTPDSPRWQLQ--HTKEAQLAIERT 324
            | |:|.|.::||..|.....|:.:.|.:|:..::...|..:.|:||||.:.  ..|||::     
  Rat   236 CIFYAFGFMVLPLFAYFIRDWRMLLLALTVPGVLCGALWWFIPESPRWLISQGRVKEAEV----- 295

  Fly   325 VGILLEAARTNGRMHKVSKELPQQLEELRERMLEPMPAVHWMHLWMGQRRSTFHLVAVHMALATF 389
              |:.:||:.||.:...:...|.:|::|..:    .|..|  |::...|.....::.: |::..:
  Rat   296 --IIRKAAKFNGIVAPSTIFDPSELQDLNSK----KPQSH--HIYDLVRTRNIRIITI-MSIILW 351

  Fly   390 MVVNTGLLLHVRSFG--------REHLVSNTLAMGLAEMLGCFLALHLTFNLSERKWQWAGGFAI 446
            :.::.|.      ||        ...:..|...:...|:....||..|..:|..|   ::...|:
  Rat   352 LTISVGY------FGLSLDTPNLHGDIYVNCFLLAAVEVPAYVLAWLLLQHLPRR---YSISAAL 407

  Fly   447 VVGCIGSICWFLAEEDMP-EVYGLTLGLLMASLPQAAVACAQSMILACLGELVPMEQRSCLSFSA 510
            .:|  ||:..|:  :.:| |::.|:..|:|..  :..:..|.||:.....||.|...|:.....:
  Rat   408 FLG--GSVLLFI--QLVPSELFYLSTALVMVG--KFGITSAYSMVYVYTAELYPTVVRNMGVGVS 466

  Fly   511 VTWARVWQLSASFLTLLRQVSPALSLSAFCLLVILGGL 548
            .|.:|:..:.:.:...|.      :...|...:::|.|
  Rat   467 STASRLGSILSPYFVYLG------AYDRFLPYILMGSL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4465NP_650847.1 2A0119 67..553 CDD:273328 110/549 (20%)
MFS 169..>303 CDD:119392 29/150 (19%)
Slc22a5NP_062142.1 2A0119 12..520 CDD:273328 110/549 (20%)
MFS 123..510 CDD:119392 89/427 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 537..557
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.