DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4465 and SLC22A31

DIOPT Version :9

Sequence 1:NP_650847.1 Gene:CG4465 / 42374 FlyBaseID:FBgn0038750 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001371692.1 Gene:SLC22A31 / 146429 HGNCID:27091 Length:446 Species:Homo sapiens


Alignment Length:446 Identity:110/446 - (24%)
Similarity:152/446 - (34%) Gaps:142/446 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 HSLTMEFDLVCLCDFFVAWSQYWHLFGLLIG----GVAATKLMRVLSPRQIYRTGIWCLLMCSLL 213
            |.|:..::|||...:.|...|..||.|.|:|    |....:..|    |.::             
Human     3 HQLSQNWNLVCGDGWKVPLEQVSHLLGWLLGCVILGAGCDRFGR----RAVF------------- 50

  Fly   214 MGLVKDFSLHCGLRCLAAVSCCF-MITSGQYIFGDITAGKYRVGTLILY---------------- 261
               |....|..||....|::..| .:...:.:.|...||    ..|.||                
Human    51 ---VASLVLTTGLGASEALAASFPTLLVLRLLHGGTLAG----ALLALYLARLELCDPPHRLAFS 108

  Fly   262 ---DCFWALGLILLPGLASNAPSWQHIY-LGVTLSLLVIVFLLPW-----TPDSPRWQLQHTKEA 317
               ..|..:|.:||||||:....|:.:. ||..:|.|:::|   |     .|:||.|.|     |
Human   109 MGAGLFSVVGTLLLPGLAALVQDWRLLQGLGALMSGLLLLF---WGFPALFPESPCWLL-----A 165

  Fly   318 QLAIERTVGILLEAARTN----GRMHKVSKELPQQLEELRERMLEPMPAVH-----------WMH 367
            ...:.|...||...|..:    |........|..:|..|..|  .|.|..|           |.:
Human   166 TGQVARARKILWRFAEASGVGPGDSSLEENSLATELTMLSAR--SPQPRYHSPLGLLRTRVTWRN 228

  Fly   368 -LWMG------------QRRS------TFHL-----VAVHMALATFMVVNTGLLLHVRSFGREH- 407
             |.:|            .|||      ||:|     ..:..|...|      |||.....||.. 
Human   229 GLILGFSSLVGGGIRASFRRSLAPQVPTFYLPYFLEAGLEAAALVF------LLLTADCCGRRPV 287

  Fly   408 LVSNTLAMGLAEMLGCFLALHLTFNLSERKWQWAGGFAIVVGCIGS-----ICWFLAEEDMPEVY 467
            |:..|:..|||.:|....|.:|.        .|...|..|:|.:.|     :....|.|..|.|.
Human   288 LLLGTMVTGLASLLLLAGAQYLP--------GWTVLFLSVLGLLASRAVSALSSLFAAEVFPTVI 344

  Fly   468 -GLTLGLLMAS--LPQAA----------------VACAQSMILACLGELVPMEQRS 504
             |..|||::.:  |.|||                |..|...:||.|..|:..|.||
Human   345 RGAGLGLVLGAGFLGQAAGPLDTLHGRQGFFLQQVVFASLAVLALLCVLLLPESRS 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4465NP_650847.1 2A0119 67..553 CDD:273328 110/446 (25%)
MFS 169..>303 CDD:119392 37/163 (23%)
SLC22A31NP_001371692.1 MFS 9..383 CDD:421695 100/421 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153492
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.