DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP92B and ARHGAP24

DIOPT Version :9

Sequence 1:NP_001287417.1 Gene:RhoGAP92B / 42371 FlyBaseID:FBgn0038747 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001020787.2 Gene:ARHGAP24 / 83478 HGNCID:25361 Length:748 Species:Homo sapiens


Alignment Length:548 Identity:128/548 - (23%)
Similarity:225/548 - (41%) Gaps:119/548 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 RIQDTIQGTEKSRFGTSLKEHLTSTNREISYIVELCCCCLLEHGLEEEGLLRVGCASTKLRRMKH 300
            :::||::  .:.|:|          ||....:||.|...:.:.||:||||.|:...:..::.::.
Human   136 KLEDTVR--YEKRYG----------NRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQD 188

  Fly   301 ALEAQHVKTPLPLDYQDPHVIGSILKLYLRELPEPLLTYNLYKDFIRIAERHSEAERK--TEIKA 363
            |.:..  :.|......|.|.:.|:|||||||||||::.|..|:||:..|:..|:.|..  .|:..
Human   189 AFDCG--EKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAK 251

  Fly   364 ILTKLPKENYANLRYLTRFLSIVQQRSALNKMSSQNLAIVMSPNMLWPRIDKSSNAPADYIGQVN 428
            .:..||..||..|:|:.|||..||..|.:||||.||||.|..||:|.|:::       |.:..:.
Human   252 QVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVE-------DPLTIME 309

  Fly   429 SSSAANIIVELLISQWDYFFIGEVEFYLTLQKQKLFVEGKSKSNSSNENLDRNDSEVMESPRYGT 493
            .:.....::.::||:.|..|..:.|           ::.|.:...||.|      |:.:....|.
Human   310 GTVVVQQLMSVMISKHDCLFPKDAE-----------LQSKPQDGVSNNN------EIQKKATMGQ 357

  Fly   494 LRRQKANAPSPPTTNGNGIIMTTSQTSHRPHAKELFPQQTPEKQEKPAKPPLPNLPQFQSPAA-- 556
            |:.::.|              .|..:..|        |.:.:|.|.|.:..:.|    .||.|  
Human   358 LQNKENN--------------NTKDSPSR--------QCSWDKSESPQRSSMNN----GSPTALS 396

  Fly   557 SQPTQTQLEPLPPPPVTPAKPVPMTRTQFFGLDNLPSPTADRKSTDSIGSFKLKPDVPQKPLLPK 621
            ...|.:....:....|:.:.|:.:.:...|...:.........|:::.|..|.: ..|...|..:
Human   397 GSKTNSPKNSVHKLDVSRSPPLMVKKNPAFNKGSGIVTNGSFSSSNAEGLEKTQ-TTPNGSLQAR 460

  Fly   622 RPTVLGVGVPKADGKSDDEGGT------------TPT----QATIDNGNGSVRFKTEHFLDKLRQ 670
            |.:.|.|...|. |....:.||            .||    .:.:.||..::|.      :|.::
Human   461 RSSSLKVSGTKM-GTHSVQNGTVRMGILNSDTLGNPTNVRNMSWLPNGYVTLRD------NKQKE 518

  Fly   671 ENGETNGTREVSSTTKENNH------NHDPPATAADQNQQQAQPQVTTPISPNSFQT-----PKR 724
            :.||......:|  |.:|.|      |.|...:........:..:::.|.:.||.::     |::
Human   519 QAGELGQHNRLS--TYDNVHQQFSMMNLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQ 581

  Fly   725 ---------PTVPAPPP-----PTNWKS 738
                     |.:..||.     |.:::|
Human   582 DFFGGNFEDPVLDGPPQDDLSHPRDYES 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP92BNP_001287417.1 BAR 27..257 CDD:299863 4/20 (20%)
RhoGAP_nadrin 245..452 CDD:239851 68/208 (33%)
ARHGAP24NP_001020787.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PH_RhoGap24 18..131 CDD:241530
PH 21..124 CDD:278594
RhoGAP_ARHGAP22_24_25 131..329 CDD:239855 69/213 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..476 27/149 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 582..641 5/28 (18%)
ATG16 <609..>723 CDD:285778 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4270
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.