Sequence 1: | NP_001287417.1 | Gene: | RhoGAP92B / 42371 | FlyBaseID: | FBgn0038747 | Length: | 740 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006521531.1 | Gene: | Arhgap8 / 73167 | MGIID: | 1920417 | Length: | 480 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 71/204 - (34%) |
---|---|---|---|
Similarity: | 103/204 - (50%) | Gaps: | 17/204 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 248 RFGTSLKEHLTSTNRE--ISYIVELCCCCLLEHGLEEEGLLRVGCASTKLRRMKHALEAQHVKTP 310
Fly 311 LPL-DYQDPHVIGSILKLYLRELPEPLLTYNLYKDFIRIAERHSEAERKTEIKAILTKLPKENYA 374
Fly 375 NLRYLTRFLSIVQQRSALNKMSSQNLAIVMSPNMLWPRIDKSSNAPADYIGQVNSSSAANIIVEL 439
Fly 440 LISQWDYFF 448 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoGAP92B | NP_001287417.1 | BAR | 27..257 | CDD:299863 | 4/8 (50%) |
RhoGAP_nadrin | 245..452 | CDD:239851 | 71/204 (35%) | ||
Arhgap8 | XP_006521531.1 | CRAL_TRIO_2 | 87..220 | CDD:372686 | |
RhoGAP | 248..436 | CDD:383032 | 70/201 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1511935at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |