DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP92B and arhgap1

DIOPT Version :9

Sequence 1:NP_001287417.1 Gene:RhoGAP92B / 42371 FlyBaseID:FBgn0038747 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001008141.1 Gene:arhgap1 / 493503 XenbaseID:XB-GENE-1015089 Length:435 Species:Xenopus tropicalis


Alignment Length:351 Identity:93/351 - (26%)
Similarity:144/351 - (41%) Gaps:82/351 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LANCGELEKTMAECIIESELETEAKVVRRLKNILDKEIQEISTLKRNVSRTLQEYTSLKRSHEAA 163
            |..|.|::              ..|:::.||:.||:.::             .:||.:...|...
 Frog    94 LPPCHEID--------------HVKLLQYLKHTLDQYVE-------------SDYTLVYLHHGLT 131

  Fly   164 IRLEEPAAKVNHIKSQQEECELKLEKERDA-------WAAQMLELIAKEDEIVSCIRDYVLNQRN 221
               .|....:..::....|.:.|.:|...|       ...:.|.::.|  .|:|......:...|
 Frog   132 ---SENKPSLGWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFK--PIISFKFGRKIFYAN 191

  Fly   222 YHERALQHVNA-------SLARIQDTIQGTEKS-----------------RFGTSLKEHLTS--- 259
            |.....:|:..       .:.:..|.|:...|:                 :||.||. ||..   
 Frog   192 YLSDLEEHMKVEQLGIPKQVLKYDDLIRSNLKTSAATQKPGPPRPPLPNQQFGISLL-HLKEKHP 255

  Fly   260 TNREISYIVELCCCCLLEHGLEEEGLLRVGCASTKLRRMKHALEAQHVKTPLPL-DYQDPHVIGS 323
            .|.:|..:|......|.|:.|..||:.|   .|.:.:.::...:..::...:.. .|.|.|:...
 Frog   256 ENDKIPLVVRDTVAFLQENALSTEGIFR---RSARTQIVREVQQKYNMGVQVTFQQYDDVHLPAV 317

  Fly   324 ILKLYLRELPEPLLTYNLYK---DFIRIAERHSEAERKTE-IKAILTKLPKENYANLRYLTRFLS 384
            |||.:||||||||||||||.   ||       |:.|:|.| ...||..||||||..|::||.||.
 Frog   318 ILKTFLRELPEPLLTYNLYSFVVDF-------SKQEQKIESTLQILQTLPKENYDVLQFLTAFLV 375

  Fly   385 IVQQRSALNKMSSQNLAIVMSPNMLW 410
            .|...:..|||::.|||:|..||:||
 Frog   376 EVSSHNEQNKMTTTNLAVVFGPNLLW 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP92BNP_001287417.1 BAR 27..257 CDD:299863 30/188 (16%)
RhoGAP_nadrin 245..452 CDD:239851 68/191 (36%)
arhgap1NP_001008141.1 CRAL_TRIO_2 83..216 CDD:404584 23/153 (15%)
RhoGAP-p50rhoGAP 240..430 CDD:239869 67/173 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1511935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.