DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP92B and RhoGAP68F

DIOPT Version :10

Sequence 1:NP_650844.1 Gene:RhoGAP92B / 42371 FlyBaseID:FBgn0038747 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001401037.1 Gene:RhoGAP68F / 39385 FlyBaseID:FBgn0036257 Length:485 Species:Drosophila melanogaster


Alignment Length:250 Identity:79/250 - (31%)
Similarity:113/250 - (45%) Gaps:19/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 LEKERDAWAAQMLELIAKEDEIVSCIRDYVLNQRNYHERALQHVNASLARIQDTIQGTEKSRFGT 251
            |::.|.|.....|:|   .|.|  |..|..||............|.:.:|.|.....| ..:||.
  Fly   227 LDELRQALGLNKLKL---PDNI--CDLDDKLNPSRKPSTPPPSSNINASRQQQHKMAT-THQFGV 285

  Fly   252 SLKEHLTSTN--REISYIVELCCCCLLEHG-LEEEGLLRVGCASTKLRRMKHALEAQHVKTPLPL 313
            .||..:.::.  ..|..||..|...|...| ::.||:.|.....:::..:|   |..:....:.|
  Fly   286 PLKFIVMNSPCLNSIPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALK---ERVNRGEDVDL 347

  Fly   314 DYQDPHVIGSILKLYLRELPEPLLTYNLYKDFIRIAERHSEAERKTEIKAILTKLPKENYANLRY 378
            ...:.|||..:||.:||:|.|||||:.||:|.....:...|...:...:.|..|||:|||...:|
  Fly   348 KSVNVHVIAGLLKSFLRDLAEPLLTFELYEDVTGFLDWPKEERSRNVTQLIREKLPEENYELFKY 412

  Fly   379 LTRFLSIVQQRSALNKMSSQNLAIVMSPNMLWPRIDKSS-------NAPADYIGQ 426
            :..||..|.....||||:|.|||||..||.||.|...:|       ||..|::.|
  Fly   413 IVEFLVRVMDCEDLNKMTSSNLAIVFGPNFLWSRSTSTSLEEIAPINAFVDFVLQ 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP92BNP_650844.1 BAR 27..257 CDD:472257 19/69 (28%)
RhoGAP_nadrin 245..452 CDD:239851 63/191 (33%)
PRK13855 495..>650 CDD:172376
RhoGAP68FNP_001401037.1 CRAL_TRIO_2 119..242 CDD:463965 5/17 (29%)
RhoGAP-p50rhoGAP 278..473 CDD:239869 64/193 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.