DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP92B and INPP5B

DIOPT Version :9

Sequence 1:NP_001287417.1 Gene:RhoGAP92B / 42371 FlyBaseID:FBgn0038747 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001352749.1 Gene:INPP5B / 3633 HGNCID:6077 Length:913 Species:Homo sapiens


Alignment Length:348 Identity:68/348 - (19%)
Similarity:128/348 - (36%) Gaps:76/348 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 IIESEL--ETEAKVVRRLKNILDKEIQEISTLKRNVSRTLQEYTSLKRSHEAAIRLEEPAAKVNH 175
            ::..||  :|..::||.|..:.:..|..:|..||.......:|..|| .....|...:.......
Human   562 VVNDELYRKTLEEIVRSLDKMENANIPSVSLSKREFCFQNVKYMQLK-VESFTIHNGQVPCHFEF 625

  Fly   176 IKSQQEECELK-----------------LEKERDAWAAQM--LELIAKEDEIVSCI-------RD 214
            |....||...|                 :|.:.:.:..:|  .:|.:.||:|...:       :|
Human   626 INKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVNKMTATKLNSGEDKIEDILVLHLDRGKD 690

  Fly   215 YVLN-QRNYHERALQHVNASLARIQDTI-----------------QGTEKSRFGTSLKEHLTSTN 261
            |.|: ..||..........:|..:::.|                 .|.:.|:..:.::     ..
Human   691 YFLSVSGNYLPSCFGSPIHTLCYMREPILDLPLETISELTLMPVWTGDDGSQLDSPME-----IP 750

  Fly   262 REISYIVELCCCCLLEHGLEEEGLLRVGCASTKLRRMKHALEAQHVKTPLPLDYQD-----PHVI 321
            :|:..:|:.    |..:.:::|.|.:    ...||.     |.:|::..|.....|     .|.:
Human   751 KELWMMVDY----LYRNAVQQEDLFQ----QPGLRS-----EFEHIRDCLDTGMIDNLSASNHSV 802

  Fly   322 GSILKLYLRELPEPLLTYNLYKDFIRIAERHSEAERKTEIKAILTKLPKENYANLRYLTRFLSIV 386
            ...|.|:|..||||::.|:.|.:.:..:..:      |..|.:::.||..:.....||..||..:
Human   803 AEALLLFLESLPEPVICYSTYHNCLECSGNY------TASKQVISTLPIFHKNVFHYLMAFLREL 861

  Fly   387 QQRSALNKMSSQNLAIVMSPNML 409
            .:.||.|.:....||.:....:|
Human   862 LKNSAKNHLDENILASIFGSLLL 884

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP92BNP_001287417.1 BAR 27..257 CDD:299863 33/189 (17%)
RhoGAP_nadrin 245..452 CDD:239851 36/170 (21%)
INPP5BNP_001352749.1 INPP5B_PH 6..150 CDD:318889
INPP5c_INPP5B 265..558 CDD:197327
RhoGAP_OCRL1 692..912 CDD:239845 42/217 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4270
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.