DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP92B and RhoGAP5A

DIOPT Version :10

Sequence 1:NP_650844.1 Gene:RhoGAP92B / 42371 FlyBaseID:FBgn0038747 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster


Alignment Length:163 Identity:50/163 - (30%)
Similarity:87/163 - (53%) Gaps:2/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 FGTSLKEHL-TSTNREISYIVELCCCCLLEHGLEEEGLLRVGCASTKLRRMKHALEAQHVKTPL- 311
            |||.|...: ...:.:|.::|..|...:...|:.:||:.||...:.::..:|.||:.:..||.: 
  Fly   302 FGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDMS 366

  Fly   312 PLDYQDPHVIGSILKLYLRELPEPLLTYNLYKDFIRIAERHSEAERKTEIKAILTKLPKENYANL 376
            ...|.:.:||...||||||.||.||:|:..|..|:.......:||::..:...:.:||..:::.|
  Fly   367 ETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPAHHSCL 431

  Fly   377 RYLTRFLSIVQQRSALNKMSSQNLAIVMSPNML 409
            :|:...|..|....|:|||:..|||.|.:|.::
  Fly   432 QYMLEHLKRVASHYAVNKMNEHNLATVFAPTLI 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP92BNP_650844.1 BAR 27..257 CDD:472257 4/7 (57%)
RhoGAP_nadrin 245..452 CDD:239851 50/163 (31%)
PRK13855 495..>650 CDD:172376
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_CHN 241..293 CDD:410356
RhoGAP_chimaerin 302..491 CDD:239837 50/163 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.