DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP92B and Arhgap8

DIOPT Version :9

Sequence 1:NP_001287417.1 Gene:RhoGAP92B / 42371 FlyBaseID:FBgn0038747 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001004242.1 Gene:Arhgap8 / 300115 RGDID:1303143 Length:425 Species:Rattus norvegicus


Alignment Length:260 Identity:76/260 - (29%)
Similarity:118/260 - (45%) Gaps:41/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 RFGTSLKEHLTSTNRE--ISYIVELCCCCLLEHGLEEEGLLRVGCASTKLRRMKHALEAQHVKTP 310
            :||.|| ::|...|:.  |..::......|.|.||..|||.|...::..:|:::...:.   ..|
  Rat   192 QFGVSL-QYLRDKNQGELIPPVLRWTVTYLREKGLHTEGLFRRSASAQTVRQVQRLYDQ---GKP 252

  Fly   311 LPL-DYQDPHVIGSILKLYLRELPEPLLTYNLYKDFIRIAERHSEAERKTEIKAILTKLPKENYA 374
            :.. ||.|.|:...|||.:|||||:||||:..|:..:.|....|.. |.|..:.||..||:.|||
  Rat   253 VNFDDYGDMHLPAVILKTFLRELPQPLLTFQAYEQILGITSVESSL-RVTHCRLILRSLPEHNYA 316

  Fly   375 NLRYLTRFLSIVQQRSALNKMSSQNLAIVMSPNMLWPRIDKSSNAPADYIGQVNSSSAANIIVEL 439
            .||||..||..|...|..|||:|.|||.|...|::|         |:..:..:::....|:..||
  Rat   317 VLRYLMGFLHEVSLESISNKMNSSNLACVFGLNLIW---------PSQGVASLSALVPLNLFTEL 372

  Fly   440 LISQWDYFFIGEVEFYLTLQKQKLFVEGKSKSNSSNENLDRNDSEVMESPRYGTLRRQKANAPSP 504
            ||..:|..|                        |:.|....:..:.:|:.:.|.:.::.....:|
  Rat   373 LIEYYDKVF------------------------SAQEGPGEHIRDTVETKQAGPVTKEFTQTGTP 413

  Fly   505  504
              Rat   414  413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP92BNP_001287417.1 BAR 27..257 CDD:299863 4/8 (50%)
RhoGAP_nadrin 245..452 CDD:239851 71/206 (34%)
Arhgap8NP_001004242.1 SEC14 12..157 CDD:238099
RhoGAP 191..381 CDD:413382 70/202 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1511935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.