DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP92B and Fam13b

DIOPT Version :9

Sequence 1:NP_001287417.1 Gene:RhoGAP92B / 42371 FlyBaseID:FBgn0038747 Length:740 Species:Drosophila melanogaster
Sequence 2:XP_017456403.1 Gene:Fam13b / 291694 RGDID:1310484 Length:871 Species:Rattus norvegicus


Alignment Length:314 Identity:81/314 - (25%)
Similarity:137/314 - (43%) Gaps:63/314 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 ALQHVNASLARIQDTIQGTEKSRFGTSLKE-----HLTSTNREISYIVELCCCCLLEH-GLEEEG 284
            :|.:.|:.||          ...||..|.|     |   .:.|:.:||......:.|| |||::|
  Rat     8 SLSNCNSDLA----------SKIFGIPLDELQQGGH---PDNEVPFIVRHVVDYIEEHGGLEQQG 59

  Fly   285 LLRV-GCASTK--LR-RMKHALEAQHVKTPLPLDYQDPHVIGSILKLYLRELPEPLLTYNLYKDF 345
            |.:| |.|.|.  || |.....|...||     :...|..| |:|:.:|:|||||::..:|:...
  Rat    60 LFQVNGNAETVEWLRQRYDSGEEVDLVK-----EADVPSAI-SLLRFFLQELPEPVIPGSLHIHL 118

  Fly   346 IRIAERH-SEAERKTEIKAILTKLPKENYANLRYLTRFLSIVQQRSALNKMSSQNLAIVMSPNML 409
            :::::.: :|.|...:::.:|.:||..||:.|::|.|||:.|..... ...|:.:||.|..|::.
  Rat   119 LQLSQDYNNEDEFGRKLRFLLQQLPPVNYSLLKFLCRFLANVASHHE-EIWSANSLAAVFGPDVF 182

  Fly   410 WPRIDKSSNAPADYIGQVNSSSAANIIVELLISQWDYFFIGEVEF------YLTLQKQKLFVEGK 468
            ....|.......:.:        :.|:..||.:.:::|...|.:|      .:|.|..:|     
  Rat   183 HIYTDVEDMKEQEIV--------SRIMAGLLENYYEFFENEEEDFSSNDLSSITEQVNEL----- 234

  Fly   469 SKSNSSNENLDRNDSEVMESPRYGTLRRQKANAP-------SPPTTNGNGIIMT 515
            |:....:|.||    .|.|.|..|.  .:.|..|       :..|...:.:|.|
  Rat   235 SEEEEEDEKLD----HVEELPEEGV--EKSAGVPEVLQSRMAENTQESDSVIAT 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP92BNP_001287417.1 BAR 27..257 CDD:299863 8/35 (23%)
RhoGAP_nadrin 245..452 CDD:239851 59/217 (27%)
Fam13bXP_017456403.1 RhoGAP_FAM13A1a 19..205 CDD:239858 56/203 (28%)
RecQL4_SLD2_NTD 535..>615 CDD:421279
RecQL4_SLD2_NTD 813..852 CDD:421279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4270
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.