DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP92B and ARHGAP8

DIOPT Version :9

Sequence 1:NP_001287417.1 Gene:RhoGAP92B / 42371 FlyBaseID:FBgn0038747 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001017526.1 Gene:ARHGAP8 / 23779 HGNCID:677 Length:464 Species:Homo sapiens


Alignment Length:384 Identity:94/384 - (24%)
Similarity:142/384 - (36%) Gaps:121/384 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 NYHERALQH-------VNASLARIQDTIQGTEKSR------------------FGTSLKEHLTST 260
            ||.....:|       :...:.|..:.:|...:.|                  ||.|| ::|...
Human   171 NYLSELHEHLKYDQLVIPPEVLRYDEKLQSLHEGRTPPPTKTPPPRPPLPTQQFGVSL-QYLKDK 234

  Fly   261 NRE--ISYIVELCCCCLLEHGLEEEGLLRVGCASTKLRRMKHALEAQHVKTPLPL-DYQDPHVIG 322
            |:.  |..::......|.|.||..|||.|   .|..::.::......:...|:.. ||.|.|:..
Human   235 NQGELIPPVLRFTVTYLREKGLRTEGLFR---RSASVQTVREIQRLYNQGKPVNFDDYGDIHIPA 296

  Fly   323 SILKLYLRELPEPLLTYNLYKDFIRIAERHSEAERKTEIKAILTKLPKENYANLRYLTRFLSIVQ 387
            .|||.:|||||:||||:..|:..:.|....|.. |.|..:.||..||:.||..||||..||..|.
Human   297 VILKTFLRELPQPLLTFQAYEQILGITCVESSL-RVTGCRQILRSLPEHNYVVLRYLMGFLHAVS 360

  Fly   388 QRSALNKMSSQNLAIVMSPNMLWPRIDKSSNAPADYIGQVNSSSAANIIVELLISQWDYFFIGEV 452
            :.|..|||:|.|||.|...|::|         |:..:..:::....|:..||||           
Human   361 RESIFNKMNSSNLACVFGLNLIW---------PSQGVSSLSALVPLNMFTELLI----------- 405

  Fly   453 EFYLTLQKQKLFVEGKSKSNSSNENLDRNDSEVMESPRYGTLRRQKANAPSPPTTNGNGIIMTTS 517
            |:|     :|:|                                   :.|..|..:|        
Human   406 EYY-----EKIF-----------------------------------STPEAPGEHG-------- 422

  Fly   518 QTSHRPHAKELFPQQTPEKQEKPAKPPLPNLPQFQSPAASQPTQTQLEPLPPPPVTPAK 576
                          ..|.:|...|.|....:|:.|:...::||      |||.|:..|:
Human   423 --------------LAPWEQGSRAAPLQEAVPRTQATGLTKPT------LPPSPLMAAR 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP92BNP_001287417.1 BAR 27..257 CDD:299863 10/60 (17%)
RhoGAP_nadrin 245..452 CDD:239851 69/227 (30%)
ARHGAP8NP_001017526.1 SEC14 12..188 CDD:238099 3/16 (19%)
RhoGAP 222..412 CDD:295372 71/219 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..464 9/29 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1511935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.