DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP92B and Fam13b

DIOPT Version :9

Sequence 1:NP_001287417.1 Gene:RhoGAP92B / 42371 FlyBaseID:FBgn0038747 Length:740 Species:Drosophila melanogaster
Sequence 2:XP_006525911.1 Gene:Fam13b / 225358 MGIID:2447834 Length:905 Species:Mus musculus


Alignment Length:411 Identity:97/411 - (23%)
Similarity:165/411 - (40%) Gaps:85/411 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 ALQHVNASLARIQDTIQGTEKSRFGTSLKE-----HLTSTNREISYIVELCCCCLLEH-GLEEEG 284
            :|.:.|:.||          ...||..|.|     |   .:.|:.:||......:.|| |||::|
Mouse     8 SLSNCNSDLA----------SKIFGIPLDELQQGGH---PDNEVPFIVRHVVDYIEEHGGLEQQG 59

  Fly   285 LLRV-GCASTK--LR-RMKHALEAQHVKTPLPLDYQDPHVIGSILKLYLRELPEPLLTYNLYKDF 345
            |.:| |.|.|.  || |.....|...||     :...|..| |:|:.:|:|||||::..:|:...
Mouse    60 LFQVNGNAETVEWLRQRYDSGEEVDLVK-----EADVPSAI-SLLRFFLQELPEPVIPGSLHIHL 118

  Fly   346 IRIAERH-SEAERKTEIKAILTKLPKENYANLRYLTRFLSIVQQRSALNKMSSQNLAIVMSPNML 409
            :::::.: :|.|...:::.:|.:||..||:.|::|.|||:.|..... ...|:.:||.|..|::.
Mouse   119 LQLSQDYNNEDEFGRKLRFLLQQLPPVNYSLLKFLCRFLANVASHHE-EIWSANSLAAVFGPDVF 182

  Fly   410 WPRIDKSSNAPADYIGQVNSSSAANIIVELLISQWDYFFIGEVEFYLTLQKQKLFVEGKSKSNSS 474
            ....|.......:.:.::.:.         |:..:..||..|.|.:.:.....:..:..|....|
Mouse   183 HIYTDVEDMKEQEIVSRIMAG---------LLENYYEFFENEEEDFSSNDLSSITEQAGSSIPHS 238

  Fly   475 NENLDRNDSEVMESPRYGTLRRQKANAPSPPTTNGNGIIMTTSQTSHRPHAKELFPQQTPEKQEK 539
            .|:.::...|.:|........|:..|..|.          ...:.....|.:|| |:   |..||
Mouse   239 LESGEQAFHEALEKGITAVKERRDVNELSE----------EEEEDEKLEHIEEL-PE---EGVEK 289

  Fly   540 PAKPP-------LPNLPQFQSPAASQPTQTQLEPLPPPP-------VTPAKPVPMTRT------Q 584
            .|..|       ..||....|..||    |:::......       :..:|||..|..      |
Mouse   290 SAGMPEVLQLRMTENLLDSDSVTAS----TRIDAAAATTTNASDGNIKCSKPVAGTTADNEVMQQ 350

  Fly   585 FFGLDNLPSPTADRKSTDSIG 605
            .|..:       |:|:.:|:|
Mouse   351 DFVFE-------DQKNNESVG 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP92BNP_001287417.1 BAR 27..257 CDD:299863 8/35 (23%)
RhoGAP_nadrin 245..452 CDD:239851 58/217 (27%)
Fam13bXP_006525911.1 RhoGAP_FAM13A1a 19..205 CDD:239858 55/204 (27%)
Drc1-Sld2 566..>645 CDD:371692
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4270
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.