DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP92B and Inpp5b

DIOPT Version :9

Sequence 1:NP_001287417.1 Gene:RhoGAP92B / 42371 FlyBaseID:FBgn0038747 Length:740 Species:Drosophila melanogaster
Sequence 2:XP_006502867.1 Gene:Inpp5b / 16330 MGIID:103257 Length:994 Species:Mus musculus


Alignment Length:388 Identity:83/388 - (21%)
Similarity:142/388 - (36%) Gaps:87/388 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 YRDTIEKIVRKLPALSGGGGSGSGSSEEQDKRTKKNSHYKIAQALDESAKELPKDMPLQKVLANC 102
            ||.|:|:|||.|                 ||....|     ..::..|.:|.            |
Mouse   649 YRKTLEEIVRSL-----------------DKMENAN-----IPSVTLSKREF------------C 679

  Fly   103 GELEKTMAECIIESELETEAKVVRRLK-----NILDKEIQEISTLKRNVSRTLQEYTSLKRSHEA 162
            .|..|.|       :|:||:..:...:     ..::|..:| |..|:.::....:...|..|| .
Mouse   680 FENVKYM-------QLQTESFTIHNSQVPCQFEFINKPDEE-SYCKQWLTARPSKGFLLPDSH-V 735

  Fly   163 AIRLE-----EPAAKVNHIKSQQEE-CELKLEKERDAWAAQMLELIAKEDEIVSCIRDYVLNQRN 221
            .|.||     ..|.|:|..|...|: ..|.||:.:|.:      |....:.:.||....:.....
Mouse   736 EIELELFVNKSTATKLNSGKDTIEDILVLHLERGKDYF------LSVSGNYLPSCFGSPIHTLCY 794

  Fly   222 YHERALQHVNASLARIQDTIQGTEKSRFGTSLKEHLTSTNREISYIVELCCCCLLEHGLEEEGLL 286
            ..|..|   :..|..:.|....:.::....|..|:.....:|:..:|:.    |..:.:::|.|.
Mouse   795 MREPIL---DLPLKTVSDLTLMSVQTADDRSQLENPMEIPKELWMMVDY----LYRNAVQQEDLF 852

  Fly   287 RVGCASTKLRRMKHALEAQHVKTPLPLDYQDP-----HVIGSILKLYLRELPEPLLTYNLYKDFI 346
            :    ...||.     |..|::..|.....|.     |.:...|.|:|..||||::.|:.|...:
Mouse   853 Q----QPGLRP-----EFDHIRDCLDTGMIDQLCANNHSVAEALLLFLESLPEPVICYSAYHSCL 908

  Fly   347 RIAERHSEAERKTEIKAILTKLPKENYANLRYLTRFLSIVQQRSALNKMSSQNLAIVMSPNML 409
            ..:..::.:      |.|:..||..:.....||..||..:.:.||.|.:....||.:....:|
Mouse   909 ECSGNYAAS------KQIILTLPSFHKNVFNYLMAFLQELLKNSANNHLDENILASIFGSLLL 965

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP92BNP_001287417.1 BAR 27..257 CDD:299863 48/229 (21%)
RhoGAP_nadrin 245..452 CDD:239851 37/170 (22%)
Inpp5bXP_006502867.1 INPP5B_PH 1..150 CDD:374793
INPP5c_INPP5B 346..639 CDD:197327
RhoGAP_OCRL1 773..991 CDD:239845 44/221 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4270
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.