DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Surf6 and RRP14

DIOPT Version :9

Sequence 1:NP_524408.1 Gene:Surf6 / 42370 FlyBaseID:FBgn0038746 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_012841.1 Gene:RRP14 / 853780 SGDID:S000001565 Length:434 Species:Saccharomyces cerevisiae


Alignment Length:365 Identity:99/365 - (27%)
Similarity:167/365 - (45%) Gaps:81/365 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EIEHNKDQKPEKEDLPAITKKFYQRVLELLTIHKVPYSKQEDEETYEEY-LLSDTEESGNKKKKQ 78
            :.:|.|.|| :||   |.:|......|.:.....:..:..||||..|:. ::.|.|  ||:...:
Yeast    87 KFKHMKMQK-QKE---ATSKVEGDSDLNVEVNDPMIIAPDEDEEEEEDIKVIFDDE--GNEIPLE 145

  Fly    79 QGKLKNQDSDDEDVEARIASIKNKLRQKKGPTTER---QQKRRESKKLKRSKGVQKLLLSSAKNL 140
              ..|:....|..||.:..:.:.||::||.....|   |.|..:.|..:::.|.::.:|:..|. 
Yeast   146 --SKKDTTEPDRSVEKKSITEEEKLQRKKNLEALRSKLQAKISDMKSKRKAPGSREAILAQRKR- 207

  Fly   141 KNENVKHQKLKN------GVVKSEQETED--------SKEQIQPVKVQPVYNQEAKIVYSKVDF- 190
            |.|..|.::|::      ..:.|:.:.||        ||::.:..|.....|.:. :::..:.| 
Yeast   208 KEELKKRKRLESEQEQDQDEIASDSDMEDIDSDLENNSKKRFKKGKKDSEINADG-VMFQNIIFD 271

  Fly   191 --------------AANPGGKAK---KSHQNPKEILKKLRDTKKHLTELREQGETDKAAEIQTDI 238
                          |....|.||   |||       .||.:.||:..|.:::.|..|..|.:   
Yeast   272 DGARATSDLQRLRKAGRTKGPAKNDVKSH-------LKLLEAKKNKMEAKDELEQIKQKEKE--- 326

  Fly   239 AWRNAFDKVEGKKVKDDTKLLQKAIKKRRVEKKKSKTKWTERKQKVEHDKEKRQKKRQENL---- 299
            .|:.|..:.||.|::||.|||:||||::..:|:||..:|:|||:.||....:|||:|:|||    
Yeast   327 KWQKAMLQAEGIKIRDDEKLLRKAIKRKEAQKRKSAIEWSERKRVVEDTISERQKRREENLRIRK 391

  Fly   300 ----EKRSKDKKNR-----------------KLKTASKRG 318
                :||:|.:|.:                 :|||..|:|
Yeast   392 DNKGKKRNKQEKMKRKYVGSAVPKKRAGFEGRLKTGKKKG 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Surf6NP_524408.1 SURF6 179..318 CDD:282751 54/181 (30%)
RRP14NP_012841.1 RRP14 8..58 CDD:406023
SURF6 221..400 CDD:398547 55/189 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346442
Domainoid 1 1.000 86 1.000 Domainoid score I1883
eggNOG 1 0.900 - - E1_KOG2885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I1499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto100085
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14369
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2266
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.