DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Surf6 and surf6

DIOPT Version :9

Sequence 1:NP_524408.1 Gene:Surf6 / 42370 FlyBaseID:FBgn0038746 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_012823715.1 Gene:surf6 / 493251 XenbaseID:XB-GENE-969953 Length:350 Species:Xenopus tropicalis


Alignment Length:256 Identity:76/256 - (29%)
Similarity:130/256 - (50%) Gaps:38/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KKKKQQGKLKNQDSDDEDVEARIASIKNKLRQKKGPTTERQQKRRESKKLKRSKGVQKLLLSSAK 138
            |.::.:|::.|:....|:||      |.:.|:|:    ||::|:|:.|:||: |..|        
 Frog   115 KIQESRGQVSNKSLTPEEVE------KRRQRRKQ----ERERKKRKRKELKK-KAAQ-------- 160

  Fly   139 NLKNENVKHQKLKNGVVKSEQETEDSKEQIQPVKVQPVYNQ-------EAKIVYSKVDFAANPGG 196
              :.|.|:.:..:.|     |||...::...|:    |:|.       ..|::..|.......|.
 Frog   161 --EPEEVEVKDAEEG-----QETNKKEKDQVPI----VFNNMEVSDELPNKVMQKKAKKERVKGN 214

  Fly   197 KAKKSHQNPKEILKKLRDTKKHLTELREQGETDKAAEIQTDIAWRNAFDKVEGKKVKDDTKLLQK 261
            ....:.:|.|::|.:|...|..|.||||:.| .||.|.::.|.|.|...|.||.|:|||..:|:.
 Frog   215 ITPMTGKNYKQLLGRLEARKTKLEELREKDE-GKAKEFESKIKWTNVLYKAEGVKIKDDEGMLKA 278

  Fly   262 AIKKRRVEKKKSKTKWTERKQKVEHDKEKRQKKRQENLEKRSKDKKNRKLKTASKRGRIIP 322
            |:|::...||:.:.:|.:|.:......::||.||:.|:.|:.:.|.|:|...|.|:|||:|
 Frog   279 ALKRKEKMKKQREKRWDKRTELTAERMQQRQDKRRRNITKKKQAKVNKKKDRARKKGRILP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Surf6NP_524408.1 SURF6 179..318 CDD:282751 45/145 (31%)
surf6XP_012823715.1 SURF6 158..316 CDD:368201 48/177 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7742
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4789
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto104859
Panther 1 1.100 - - LDO PTHR14369
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2266
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.090

Return to query results.
Submit another query.