DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Surf6 and surf6

DIOPT Version :9

Sequence 1:NP_524408.1 Gene:Surf6 / 42370 FlyBaseID:FBgn0038746 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_957359.1 Gene:surf6 / 394040 ZFINID:ZDB-GENE-040426-1333 Length:362 Species:Danio rerio


Alignment Length:327 Identity:88/327 - (26%)
Similarity:159/327 - (48%) Gaps:59/327 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NKDQKPEKEDLPAITKKFYQRVLE---LLTIHKVPYSKQED---EETYEEYLLSDTEESGNKKKK 77
            ||: ||..:..||.|....::.::   .:|.:|...:..:|   .:...:.|....|||     :
Zfish    66 NKN-KPVVKGTPATTPPAQRKTVQNGTSVTQNKPGGAASKDFNAVDILRQRLHQKIEES-----R 124

  Fly    78 QQGKLKNQDSDDEDVEARIASIKNKLRQKKGPTTERQQKRRESKKLKRSKGVQKLLLSSAKNLKN 142
            .||..|:..||:         :|.| |:|:....||::::|:..:||:        |:.|..|:.
Zfish   125 GQGTPKDPSSDE---------VKMK-REKRKQERERRKRKRKEFRLKK--------LADAAGLQP 171

  Fly   143 ENVKHQKLKNGVVKSEQETEDSKEQIQPVKVQPVYNQEAKIVYSKVDFAANPGGKAKK------- 200
            .:||.       :|:|.|.:.:.....|.|     .:::.||::|::...:...|..|       
Zfish   172 VDVKE-------IKTEPEEDSTATSSVPAK-----KEQSFIVFNKMEVGEDYVDKGTKMMEKKKR 224

  Fly   201 ---------SHQNPKEILKKLRDTKKHLTELREQGETDKAAEIQTDIAWRNAFDKVEGKKVKDDT 256
                     :.:|.|::|.::...|.||.:|||:.| .||.:.:..:.|.|...|.||.|:||:.
Zfish   225 KVKGTLTPLTGKNYKQLLTRIEARKAHLEQLREKDE-GKAKKEEEKMKWTNVLYKAEGMKIKDNE 288

  Fly   257 KLLQKAIKKRRVEKKKSKTKWTERKQKVEHDKEKRQKKRQENLEKRSKDKKNRKLKTASKRGRII 321
            |||..::||:...|.:.|.||..|.::|....:|||.||:.|:::|:..|..::.:.|.|:||::
Zfish   289 KLLHASLKKKEKMKAQRKKKWAMRSEQVVEKMQKRQDKRKRNIKRRADAKIEKRKQKARKKGRVL 353

  Fly   322 PG 323
            ||
Zfish   354 PG 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Surf6NP_524408.1 SURF6 179..318 CDD:282751 46/154 (30%)
surf6NP_957359.1 SURF6 194..350 CDD:282751 47/161 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595760
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2266
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.