DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Surf6 and SPAC8C9.10c

DIOPT Version :9

Sequence 1:NP_524408.1 Gene:Surf6 / 42370 FlyBaseID:FBgn0038746 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_594281.1 Gene:SPAC8C9.10c / 2542305 PomBaseID:SPAC8C9.10c Length:154 Species:Schizosaccharomyces pombe


Alignment Length:143 Identity:37/143 - (25%)
Similarity:58/143 - (40%) Gaps:31/143 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KEDLPAITKKFYQRVLELLTIHKVPYSKQEDEETYEEY------------LLSDTEESGNKKKK- 77
            :|.|..|..|.|.|.      |.....||: :.|.||.            |::|.::...|..| 
pombe    16 EELLSYIPAKLYYRE------HTANQWKQK-KSTLEEKKERRKMKFSLDGLVNDADDDSQKSSKW 73

  Fly    78 QQGKLKNQDSDDEDVEAR-IASIKNKLRQK------KGPTTERQQKRRESKKLKRSKGVQKLLLS 135
            :|....:.|:|..|..|. ::.|:.||..|      |....:..|||:..:.::..|..||   .
pombe    74 EQSSTMSDDTDVSDRHAESMSQIRGKLASKIQDLREKRKAGDLNQKRQNKRPVENEKDSQK---G 135

  Fly   136 SAKNLKNENVKHQ 148
            |.|: |.:..||:
pombe   136 SGKS-KVQKKKHK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Surf6NP_524408.1 SURF6 179..318 CDD:282751
SPAC8C9.10cNP_594281.1 RRP14 7..54 CDD:292098 12/44 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14369
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.