DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Surf6 and SPBC947.07

DIOPT Version :9

Sequence 1:NP_524408.1 Gene:Surf6 / 42370 FlyBaseID:FBgn0038746 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_595269.1 Gene:SPBC947.07 / 2541261 PomBaseID:SPBC947.07 Length:233 Species:Schizosaccharomyces pombe


Alignment Length:235 Identity:68/235 - (28%)
Similarity:115/235 - (48%) Gaps:31/235 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KNKLRQKKGPTTER-QQKRRESKKLKRSKGVQKLLLSSAKNLKNENVKHQKLKNGVVKSEQETE- 162
            ||.||.|.....:. :.:|:.::|:.|:     |||...|.......:.:||.....|::||:: 
pombe     7 KNDLRAKLAEKIQTFRSQRKATEKVDRA-----LLLQRRKEKAKARAEAKKLAKKESKAKQESKV 66

  Fly   163 ---DSKEQIQPVKVQPVYNQEAKIVYSKV----DFAANPGGKAKKSHQNPKEI---LKKLRDTKK 217
               |:......:..:...|.::.|.|..:    |..:|...|.....:.|.::   ||.|...|:
pombe    67 AAYDTGNSSDNIADEENDNHKSTITYGTLIVGDDKFSNGKLKVAGKKRGPTDVFGALKHLEAKKR 131

  Fly   218 HLTELREQGETDKAAEIQTDIAWRNAFDKVEGKKVKDDTKLLQKAIKKRRVEKKKSKTKWTERKQ 282
            .:..:.|    :|..:|:....|.....:.||||:||:.:||:|:|:::..|||||...|.||| 
pombe   132 RIESMDE----EKRRKIEESDKWHRVLLQAEGKKLKDNEQLLKKSIRRKEKEKKKSSDAWKERK- 191

  Fly   283 KVEHDKEK-----RQKKRQENLEKRSKDKKNRKLKTASKR 317
                |.||     ||::|:|||:||.:.||::|.|...|:
pombe   192 ----DNEKKAMLMRQQRREENLKKRRESKKSKKGKAPKKK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Surf6NP_524408.1 SURF6 179..318 CDD:282751 49/151 (32%)
SPBC947.07NP_595269.1 SURF6 <108..209 CDD:282751 36/109 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2885
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14369
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2266
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.