DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4733 and rsa-1

DIOPT Version :9

Sequence 1:NP_001247197.1 Gene:CG4733 / 42368 FlyBaseID:FBgn0038744 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_492683.1 Gene:rsa-1 / 172886 WormBaseID:WBGene00007710 Length:404 Species:Caenorhabditis elegans


Alignment Length:321 Identity:72/321 - (22%)
Similarity:124/321 - (38%) Gaps:65/321 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   580 HEAASRFVYILSRG---------QRFRSYIVPED----LVPM-----------VQDVVDTHPGLA 620
            |...|.||.|.:..         :..|:.|..|:    |:|.           :||.|.|| .:.
 Worm   106 HNTVSNFVKITNYNLTIDITLLEELVRTVIHAEESYIKLLPFSENSTEISSYSLQDFVATH-FIP 169

  Fly   621 FLKEATEFHSRYVHTVIARIFYSVNRSWSGKITIAELKRSDLLEMISLLEEEEDI---NQIMA-- 680
            .:.|..|....|....:..||:.:.   :.:.....||  |||....||:.||.|   |..::  
 Worm   170 IMIEEPENPVYYTAYAVGTIFFLLG---ARRRDCVYLK--DLLASTLLLQLEECIHAENHCLSPP 229

  Fly   681 ---FFSYEHFYVIYCKFWELDKDHDLLINQEDLAKHSDHALSSRIVERIFSGCVTRSDNKKAPED 742
               .|:...|.....:|..||.....|:...||....|...:....:|||...:|..|       
 Worm   230 KIDVFTVAQFRTTLSEFRFLDSQRKGLLAPADLKFFRDGIFNEVFTKRIFEISITYED------- 287

  Fly   743 EAKMSYTDFVWFILSEEDKRTPTAIEYWFRCMDVDGDGVLSMYELEYFYEEQQQRMEGIGIECLP 807
             .::.:..||.|:.:.:.:.|..:.:|.|..:|:..||:|.        ||:.:.:....::.||
 Worm   288 -GRIDFKAFVDFVTALKFRHTTASAKYHFEILDLKDDGLLD--------EEEIRSISSFQLQNLP 343

  Fly   808 F----------EDCLCQMLDMIKPANRDCITLGDLKRCKMTHVFFDTFFNLEKYLDHEQRD 858
            .          |....::.||:: .|::.|||.:....:|...|.....|.:.|:.:|:|:
 Worm   344 DYVPEDNSVNPEVATAELRDMMR-LNQNGITLEEFLANRMNSTFAGFLSNSDDYMKYERRE 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4733NP_001247197.1 EF-hand_7 690..791 CDD:290234 22/100 (22%)
rsa-1NP_492683.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.