DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaE and Rgr

DIOPT Version :9

Sequence 1:NP_524407.1 Gene:ninaE / 42367 FlyBaseID:FBgn0002940 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_067315.1 Gene:Rgr / 57811 MGIID:1929473 Length:291 Species:Mus musculus


Alignment Length:266 Identity:72/266 - (27%)
Similarity:108/266 - (40%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNTPMMGINLYFETWVLGPMMCDIYAGLGSA 132
            ||:.|:.|..|..||||:||||::||::|.||.: |..:..::.....|..|...|.::...|.|
Mouse    34 NGLTIFSFCKTPDLRTPSNLLVLSLALADTGISL-NALVAAVSSLLRRWPHGSEGCQVHGFQGFA 97

  Fly   133 FGCSSIWSMCMISLDRY-QVIVKGMAGRPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGN 196
            ...:||.....::..|| ....:........|||.|    ::|..|:.|...|..||..|..|..
Mouse    98 TALASICGSAAVAWGRYHHYCTRRQLAWDTAIPLVL----FVWMSSAFWASLPLMGWGHYDYEPV 158

  Fly   197 LTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLR 261
            .|.|.:||...|.|..|:|...:.|.:.:|||:...||.|                  |..|..|
Mouse   159 GTCCTLDYSRGDRNFISFLFTMAFFNFLVPLFITHTSYRF------------------MEQKFSR 205

  Fly   262 SSEDAEKSAEGKLAKVALVTITLWFMAWTPY-LVINCMGLFKFEGLTPLNTIWGACFAKSAACYN 325
            |         |.|.....:...:..:.|.|| |:.....:.....::|...:..|..||:....|
Mouse   206 S---------GHLPVNTTLPGRMLLLGWGPYALLYLYAAIADVSFISPKLQMVPALIAKTMPTIN 261

  Fly   326 PIVYGI 331
            .|.|.:
Mouse   262 AINYAL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaENP_524407.1 7tmA_photoreceptors_insect 52..340 CDD:320207 72/266 (27%)
TM helix 1 53..77 CDD:320207 4/8 (50%)
TM helix 2 86..108 CDD:320207 10/21 (48%)
TM helix 3 124..146 CDD:320207 4/21 (19%)
TM helix 4 168..184 CDD:320207 3/15 (20%)
TM helix 5 212..235 CDD:320207 7/22 (32%)
TM helix 6 275..297 CDD:320207 4/22 (18%)
TM helix 7 308..333 CDD:320207 7/24 (29%)
RgrNP_067315.1 Csx17_I-U <38..>139 CDD:276221 31/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.