DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaE and opn8b

DIOPT Version :9

Sequence 1:NP_524407.1 Gene:ninaE / 42367 FlyBaseID:FBgn0002940 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001303874.1 Gene:opn8b / 569628 ZFINID:ZDB-GENE-070705-120 Length:357 Species:Danio rerio


Alignment Length:320 Identity:71/320 - (22%)
Similarity:146/320 - (45%) Gaps:32/320 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 AYMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNTPMMGINLYFETWVLG 119
            |::::|.::|..||.:|:.:.....:...|..||.:|||::|.|..:|..|:...:.:...|:.|
Zfish    18 AFLLLIAILSILGNLMVLVMAYKRSNHMKPPELLSVNLAVTDLGAAVTMYPLAVASAWNHHWIGG 82

  Fly   120 PMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAGRPMTIPLALGKI---------AYIWF 175
            .:.|..|..:|..||.:|:.::.::::.|:.|        .:|:.....||         |..|.
Zfish    83 DVSCVYYGLMGFLFGAASMMTLTIMAIVRFIV--------SLTLQSPKEKISKRNAKILVATTWL 139

  Fly   176 MSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAA 240
            .:.:|.:.|..||.:|.||....||.:|:.:...:.:|::|...:....:|..:|...|..|...
Zfish   140 YALLWAIFPLIGWGKYGPEPFGLSCTLDWRDMKEHSQSFVITIFLMNLILPAIIIVSCYCGIALR 204

  Fly   241 VSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITLWFM-AWTPYLVINCMGLFKFE 304
            :....|:|.:.....|:..::           :...|..|.|::.|: .|.||.:::...:::..
Zfish   205 LYVTYKSMDDSNHVPNMIKMQ-----------RRLMVIAVLISIGFVGCWAPYGIVSLWSIYRPG 258

  Fly   305 GLTPLNTIWGAC-FAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQ 363
            ...|.......| |||::..|||.:|.|....::..:.:....|  |:.:..:.:||:::
Zfish   259 DSIPAEVSMLPCLFAKTSTVYNPFIYYIFSKTFKREVNQLSRFC--GRSNICRPTDAKNR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaENP_524407.1 7tmA_photoreceptors_insect 52..340 CDD:320207 67/295 (23%)
TM helix 1 53..77 CDD:320207 6/21 (29%)
TM helix 2 86..108 CDD:320207 9/21 (43%)
TM helix 3 124..146 CDD:320207 5/21 (24%)
TM helix 4 168..184 CDD:320207 5/24 (21%)
TM helix 5 212..235 CDD:320207 4/22 (18%)
TM helix 6 275..297 CDD:320207 7/22 (32%)
TM helix 7 308..333 CDD:320207 10/25 (40%)
opn8bNP_001303874.1 7tm_1 30..284 CDD:278431 62/272 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.