DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaE and opn6b

DIOPT Version :9

Sequence 1:NP_524407.1 Gene:ninaE / 42367 FlyBaseID:FBgn0002940 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001303879.1 Gene:opn6b / 557053 ZFINID:ZDB-GENE-030616-402 Length:391 Species:Danio rerio


Alignment Length:318 Identity:93/318 - (29%)
Similarity:142/318 - (44%) Gaps:59/318 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNTPMMGINLYFET----- 115
            |::::|.:||.|||.||.:....:....|.:.|.:||||||..|.|... ..||...|:.     
Zfish    27 YLVILGWLSWIGNGTVILLLTKQRKALEPQDFLTLNLAISDASISIFGY-SRGILEVFDVFRDEG 90

  Fly   116 ------WVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAGRP--------MTIPLA 166
                  |.     |.:...|...||..||.::..||:.||   :||.  .|        ..|.|.
Zfish    91 YLIKTFWT-----CKVDGFLILLFGLISINTLTAISVIRY---IKGC--HPHHAHHINKRNICLV 145

  Fly   167 LGKIAYIWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFV-------YY 224
               |..:|.....|..||..||..|...|..| |     |.||....|.|.:.::|       ::
Zfish   146 ---ITAVWLFCLFWAGAPLLGWGSYRARGYGT-C-----EIDWTRALYSIPFKLYVIGIFFFNFF 201

  Fly   225 IPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITLWFMAW 289
            :|||:|.::|..||..|::..|:  .|...::        :.:|..|..:.:|:|:....:.:||
Zfish   202 VPLFIIVFAYVSIIRTVNSSHKS--SQGGDVS--------ERQKKIERSITRVSLILCAAFLLAW 256

  Fly   290 TPYLVINCMGLFKFEGLTPLNTIWGACFAKSAACYNPIVY-GISHPKYRLALKEKCPC 346
            :||.||:......:: :..||.|..:.|||||:.|||.:| |:| .|:|..|:....|
Zfish   257 SPYAVISMWSALGYQ-IPTLNGILASLFAKSASFYNPFIYIGMS-SKFRKDLQALFYC 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaENP_524407.1 7tmA_photoreceptors_insect 52..340 CDD:320207 91/310 (29%)
TM helix 1 53..77 CDD:320207 9/20 (45%)
TM helix 2 86..108 CDD:320207 9/21 (43%)
TM helix 3 124..146 CDD:320207 6/21 (29%)
TM helix 4 168..184 CDD:320207 3/15 (20%)
TM helix 5 212..235 CDD:320207 7/29 (24%)
TM helix 6 275..297 CDD:320207 8/21 (38%)
TM helix 7 308..333 CDD:320207 13/25 (52%)
opn6bNP_001303879.1 7tm_1 38..295 CDD:278431 82/287 (29%)
7tm_4 <204..306 CDD:304433 35/113 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.