DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaE and tmtops3b

DIOPT Version :9

Sequence 1:NP_524407.1 Gene:ninaE / 42367 FlyBaseID:FBgn0002940 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001269304.1 Gene:tmtops3b / 102031126 ZFINID:ZDB-GENE-091204-311 Length:379 Species:Danio rerio


Alignment Length:314 Identity:86/314 - (27%)
Similarity:143/314 - (45%) Gaps:33/314 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NGSVVDKVTP-DMAHLISPYWNQFPAMDPIWAKILTAYMIMIGMISWCG---NGVVIYIFATTKS 80
            |||::|.::| |........:              |...:::|:|...|   |.||:.:||....
Zfish    13 NGSLLDSLSPADQTGFSRAGY--------------TVVAVILGIIFVFGFLCNFVVLLVFARFHV 63

  Fly    81 LRTPANLLVINLAISDFGIMITNTPMMGINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMCMIS 145
            ||||.||:::|:.:||..:.:..||:.........|:.|...|..|....:.||..|:.|:.::|
Zfish    64 LRTPINLILLNIIVSDMLVCLFGTPLSFAASVHGRWLTGVHGCRWYGFANALFGIVSLVSLAVLS 128

  Fly   146 LDRYQVIVKGMAGRPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWN 210
            .:||..|:............|...|...|..|.:|.:.|..|||.|.|||..|:|.:.:.:|...
Zfish   129 YERYSTILCSSKADASDYRKAWLFITGCWLYSLLWTVPPLLGWSSYGPEGPGTTCSVQWNKRSPE 193

  Fly   211 PRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLA 275
            .|||:|...:|...:||.|:.|.|..|:.|:  |..|      |:|       :.|.:..|..:.
Zfish   194 TRSYVICLFVFCLLLPLLLMVYCYGKILIAI--HGVA------KIN-------QTAAQRRETHVL 243

  Fly   276 KVALVTITLWFMAWTPYLVINCMGLFKFEGLTPLNTIWGACFAKSAACYNPIVY 329
            .:.:..::.:.:.|.||.|:..:|.|.....:|..::..:..|||:...|||:|
Zfish   244 VMVVSMVSCYLLCWMPYGVMALLGTFSAGITSPTASVVSSLLAKSSTVLNPIIY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaENP_524407.1 7tmA_photoreceptors_insect 52..340 CDD:320207 80/281 (28%)
TM helix 1 53..77 CDD:320207 8/26 (31%)
TM helix 2 86..108 CDD:320207 7/21 (33%)
TM helix 3 124..146 CDD:320207 5/21 (24%)
TM helix 4 168..184 CDD:320207 4/15 (27%)
TM helix 5 212..235 CDD:320207 9/22 (41%)
TM helix 6 275..297 CDD:320207 4/21 (19%)
TM helix 7 308..333 CDD:320207 8/22 (36%)
tmtops3bNP_001269304.1 7tm_1 51..297 CDD:278431 75/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.