DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaE and tmtops3a

DIOPT Version :9

Sequence 1:NP_524407.1 Gene:ninaE / 42367 FlyBaseID:FBgn0002940 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001269303.1 Gene:tmtops3a / 102031125 ZFINID:ZDB-GENE-130828-1 Length:379 Species:Danio rerio


Alignment Length:283 Identity:79/283 - (27%)
Similarity:135/283 - (47%) Gaps:25/283 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TAYMIMIGMISWCG---NGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNTPMMGINLYFET 115
            |...:.:|.|...|   |..|:.:||..:||.||.||:::|:::||..:.:..||....:..:..
Zfish    45 TVTAVCLGAILLLGCLNNLFVLLVFARFRSLWTPINLILLNISVSDILVCLFGTPFSFASSLYGK 109

  Fly   116 WVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAGRPMTIPLALGKIAYIWFMSSIW 180
            |:||...|..|....|.||..|:.|:.::|.:||..:::...........|...:|..|..|.:|
Zfish   110 WLLGHHGCKWYGFANSLFGIVSLMSLSILSYERYAALLRATKADVSDFRRAWLCVAGSWLYSLLW 174

  Fly   181 CLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHE 245
            .|.|..|||.|.|||..|:|.:.:..|..:..||::...||...:||.|:.:.|..|:..:..  
Zfish   175 TLPPFLGWSNYGPEGPGTTCSVQWHLRSTSSISYVMCLFIFCLLLPLVLMIFCYGKILLLIKG-- 237

  Fly   246 KAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITL---WFMAWTPYLVINCMGLFKFEGL- 306
                  ..|:|:.:.:..|:          .:.|:.:|:   :.:.|.||.|:..:..|...|| 
Zfish   238 ------VTKINLLTAQRREN----------HILLMVVTMVSCYLLCWMPYGVVALLATFGRTGLI 286

  Fly   307 TPLNTIWGACFAKSAACYNPIVY 329
            ||:.:|..:..|||:...||::|
Zfish   287 TPVTSIVPSVLAKSSTVVNPVIY 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaENP_524407.1 7tmA_photoreceptors_insect 52..340 CDD:320207 79/283 (28%)
TM helix 1 53..77 CDD:320207 7/25 (28%)
TM helix 2 86..108 CDD:320207 7/21 (33%)
TM helix 3 124..146 CDD:320207 6/21 (29%)
TM helix 4 168..184 CDD:320207 5/15 (33%)
TM helix 5 212..235 CDD:320207 7/22 (32%)
TM helix 6 275..297 CDD:320207 6/24 (25%)
TM helix 7 308..333 CDD:320207 8/22 (36%)
tmtops3aNP_001269303.1 7tm_1 62..309 CDD:278431 74/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.