DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ask1 and YDA

DIOPT Version :9

Sequence 1:NP_477089.3 Gene:Ask1 / 42366 FlyBaseID:FBgn0014006 Length:1363 Species:Drosophila melanogaster
Sequence 2:NP_001319310.1 Gene:YDA / 842674 AraportID:AT1G63700 Length:883 Species:Arabidopsis thaliana


Alignment Length:399 Identity:136/399 - (34%)
Similarity:213/399 - (53%) Gaps:47/399 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   590 VLGKGTYGTVYAARDKQTQVRIAIKEV-----PEKNSQDVQPLHEEIKLHSQLRHRNIVRYLGSC 649
            :||.|::|.||...:.::....|:|||     ..|:.:..|.|.:||.:.|:|||:|||:|.||.
plant   405 LLGMGSFGHVYLGFNSESGEMCAMKEVTLCSDDPKSRESAQQLGQEISVLSRLRHQNIVQYYGSE 469

  Fly   650 SENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNV 714
            :.:....|::|.|.|||:..||: ::|..  .|:.:..|::|||.||.|||.::.|||||||.|:
plant   470 TVDDKLYIYLEYVSGGSIYKLLQ-EYGQF--GENAIRNYTQQILSGLAYLHAKNTVHRDIKGANI 531

  Fly   715 LVNTYSGVVKISDFGTSKRL-ARINPMTETFTGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVE 778
            ||:.: |.||::|||.:|.: |:..|:  :|.|:..:|||||| :...|...|.||||.|||.:|
plant   532 LVDPH-GRVKVADFGMAKHITAQSGPL--SFKGSPYWMAPEVI-KNSNGSNLAVDIWSLGCTVLE 592

  Fly   779 MATGKPPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFL 843
            |||.|||:.:.... .||||:|..|:.|:||:.||...|:|:.:|...:..:||:|:|||:..|:
plant   593 MATTKPPWSQYEGV-PAMFKIGNSKELPDIPDHLSEEGKDFVRKCLQRNPANRPTAAQLLDHAFV 656

  Fly   844 QDKPRKVRP--------ALPINTEFGRSISVPADRFVHKTTPPLSYNTTCNTPTTPELDITHSSS 900
            ::.....||        |:.:.:...||:.:...|    :.|.|......|   ..:..:.|.|.
plant   657 RNVMPMERPIVSGEPAEAMNVASSTMRSLDIGHAR----SLPCLDSEDATN---YQQKGLKHGSG 714

  Fly   901 VDIDELPSNQ-----------FMLERRNSHGFLLSPEIEPSTPSLRTSISETSE--TDGFYRLKK 952
            ..|.:.|.|.           |     :||...:|....||..|...::|.:|.  |.....:..
plant   715 FSISQSPRNMSCPISPVGSPIF-----HSHSPHISGRRSPSPISSPHALSGSSTPLTGCGGAIPF 774

  Fly   953 DSQRRTTLS 961
            ..||:||::
plant   775 HHQRQTTVN 783

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ask1NP_477089.3 DUF4071 74..444 CDD:290020
STKc_ASK 576..843 CDD:270794 107/258 (41%)
S_TKc 590..843 CDD:214567 107/258 (41%)
YDANP_001319310.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 209 1.000 Domainoid score I802
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2588
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.