DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ask1 and MEKK1

DIOPT Version :9

Sequence 1:NP_477089.3 Gene:Ask1 / 42366 FlyBaseID:FBgn0014006 Length:1363 Species:Drosophila melanogaster
Sequence 2:NP_192590.1 Gene:MEKK1 / 826409 AraportID:AT4G08500 Length:608 Species:Arabidopsis thaliana


Alignment Length:272 Identity:113/272 - (41%)
Similarity:170/272 - (62%) Gaps:23/272 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   590 VLGKGTYGTVYAARDKQTQVRIAIKEVP--EKNSQD---VQPLHEEIKLHSQLRHRNIVRYLGSC 649
            :||:|::|:||......... .|:|||.  ::.||.   :|.|..||||.|||:|:|||||.|:.
plant   338 LLGRGSFGSVYEGISGDGDF-FAVKEVSLLDQGSQAQECIQQLEGEIKLLSQLQHQNIVRYRGTA 401

  Fly   650 SENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNV 714
            .:.....||:|.|..|||..|.:..  .|:|  |.::.|::|||:||||||::..:|||||..|:
plant   402 KDGSNLYIFLELVTQGSLLKLYQRY--QLRD--SVVSLYTRQILDGLKYLHDKGFIHRDIKCANI 462

  Fly   715 LVNTYSGVVKISDFGTSKRLARINPMTETFTGTLQYMAPEVID-QGVRGYGPAADIWSFGCTNVE 778
            ||:. :|.||::|||.:| :::.|.: ::..||..:||||||: :...|||..|||||.|||.:|
plant   463 LVDA-NGAVKLADFGLAK-VSKFNDI-KSCKGTPFWMAPEVINRKDSDGYGSPADIWSLGCTVLE 524

  Fly   779 MATGKPPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFL 843
            |.||:.|:.:|.... |:|::| ....|.:|:.||.:|:.|||:|..::..:||:|::||..|| 
plant   525 MCTGQIPYSDLEPVQ-ALFRIG-RGTLPEVPDTLSLDARLFILKCLKVNPEERPTAAELLNHPF- 586

  Fly   844 QDKPRKVRPALP 855
                  ||..||
plant   587 ------VRRPLP 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ask1NP_477089.3 DUF4071 74..444 CDD:290020
STKc_ASK 576..843 CDD:270794 108/258 (42%)
S_TKc 590..843 CDD:214567 108/258 (42%)
MEKK1NP_192590.1 STKc_MEKK1_plant 332..587 CDD:270802 109/265 (41%)
S_TKc 333..587 CDD:214567 109/265 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 209 1.000 Domainoid score I802
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2588
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.