DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ask1 and Map3k1

DIOPT Version :9

Sequence 1:NP_477089.3 Gene:Ask1 / 42366 FlyBaseID:FBgn0014006 Length:1363 Species:Drosophila melanogaster
Sequence 2:NP_036075.2 Gene:Map3k1 / 26401 MGIID:1346872 Length:1493 Species:Mus musculus


Alignment Length:265 Identity:101/265 - (38%)
Similarity:153/265 - (57%) Gaps:21/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   591 LGKGTYGTVYAARDKQTQVRIAIKEV------PEKNSQDVQPLHEEIKLHSQLRHRNIVRYLGSC 649
            :|.|.:.:.|.|:|..|...:|:|:|      ..:..:.|:.|.|||::...|.|.||:|.||:.
Mouse  1230 IGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGHLNHPNIIRMLGAT 1294

  Fly   650 SENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNV 714
            .|...:.:|:|.:.|||::.|| :|:|..|  ||.:..|::|:|.||.||||..|:|||:||.|:
Mouse  1295 CEKSNYNLFIEWMAGGSVAHLL-SKYGAFK--ESVVINYTEQLLRGLSYLHENQIIHRDVKGANL 1356

  Fly   715 LVNTYSGVVKISDFGTSKRLARINPMTETF----TGTLQYMAPEVIDQGVRG--YGPAADIWSFG 773
            |:::....::|:|||.:.|||........|    .||:.:|||||:    ||  ||.:.|:||.|
Mouse  1357 LIDSTGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVL----RGQQYGRSCDVWSVG 1417

  Fly   774 CTNVEMATGKPPF-IELGSAHAAM-FKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQ 836
            |..:|||..|||: .|..|.|.|: ||:......|:||..||...::..|||..:...|||.:.:
Mouse  1418 CAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRE 1482

  Fly   837 LLEDP 841
            ||:.|
Mouse  1483 LLKHP 1487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ask1NP_477089.3 DUF4071 74..444 CDD:290020
STKc_ASK 576..843 CDD:270794 101/265 (38%)
S_TKc 590..843 CDD:214567 101/265 (38%)
Map3k1NP_036075.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..178
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..300
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..431
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 506..531
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 895..914
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 927..957
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 992..1066
STKc_MEKK1 1223..1490 CDD:270800 101/265 (38%)
S_TKc 1224..1489 CDD:214567 101/265 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.