DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4562 and yejF

DIOPT Version :9

Sequence 1:NP_001262747.1 Gene:CG4562 / 42362 FlyBaseID:FBgn0038740 Length:1408 Species:Drosophila melanogaster
Sequence 2:NP_416685.1 Gene:yejF / 946689 ECOCYCID:EG12041 Length:529 Species:Escherichia coli


Alignment Length:282 Identity:71/282 - (25%)
Similarity:133/282 - (47%) Gaps:50/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1053 EPEGDFESKPNKKPPKDWPEDGKIVFDDLSLKY-FP------DKAADY--VLRSLNIAIEGCEKV 1108
            ||.||         |...||....:.|...|:. ||      .:..|:  |:::::..:...|.:
E. coli   260 EPSGD---------PVPLPEPASTLLDVEQLQVAFPIRKGILKRIVDHNVVVKNISFTLRAGETL 315

  Fly  1109 GIVGRTGAGKSSLINALFRLSYNEGAILIDRRDTNDLG---LHDLRSKISIIPQEPVLFSGTMRY 1170
            |:||.:|:|||:...||.||..::|:|:.|.:...:|.   |..:|.:|.::.|:|       ..
E. coli   316 GLVGESGSGKSTTGLALLRLINSQGSIIFDGQPLQNLNRRQLLPIRHRIQVVFQDP-------NS 373

  Fly  1171 NLDPFDEYSDAKLWESLEE------------VKLKQVVADLPS-GLQSKISEG-GTNFSVGQRQL 1221
            :|:|     ...:.:.:||            .:.:||:|.:.. ||..:.... ...||.||||.
E. coli   374 SLNP-----RLNVLQIIEEGLRVHQPTLSAAQREQQVIAVMHEVGLDPETRHRYPAEFSGGQRQR 433

  Fly  1222 VCLARAILRENRILVMDEATANVDPQTDALIQTTIRN--KFKDCTVLTIAHRLHTVMD-SDKVLV 1283
            :.:|||::.:..::::||.|:::|....|.|.|.:::  :......|.|:|.||.|.. ..:|::
E. coli   434 IAIARALILKPSLIILDEPTSSLDKTVQAQILTLLKSLQQKHQLAYLFISHDLHVVRALCHQVII 498

  Fly  1284 MDAGKAVEFGSPFELLTTSEKK 1305
            :..|:.||.|....:..|.:::
E. coli   499 LRQGEVVEQGPCARVFATPQQE 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4562NP_001262747.1 CFTR_protein 12..1300 CDD:273530 70/275 (25%)
ABC_membrane 98..367 CDD:294371
ABCC_MRP_domain1 443..643 CDD:213217
ABC_membrane 799..1027 CDD:294371
ABCC_MRP_domain2 1074..1295 CDD:213211 63/249 (25%)
yejFNP_416685.1 PRK15134 1..529 CDD:237917 71/282 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I246
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
22.050

Return to query results.
Submit another query.