DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4562 and NAP5

DIOPT Version :9

Sequence 1:NP_001262747.1 Gene:CG4562 / 42362 FlyBaseID:FBgn0038740 Length:1408 Species:Drosophila melanogaster
Sequence 2:NP_177289.1 Gene:NAP5 / 843474 AraportID:AT1G71330 Length:324 Species:Arabidopsis thaliana


Alignment Length:331 Identity:114/331 - (34%)
Similarity:173/331 - (52%) Gaps:37/331 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 MDKHRYRTVVKRCALERDFELLPYADKTIVGERGASLSGGQKARISLARAVYRKADIYLLDDPLS 596
            ||:.||..|::.|:|.:|.|:|.:.|:|::||||.:||||||.||.:|||:|:.|||||.|||.|
plant     1 MDRERYDKVIEACSLSKDLEILSFGDQTVIGERGINLSGGQKQRIHIARALYQDADIYLFDDPFS 65

  Fly   597 AVDTHVGRHLFDQCMRGFLREEIVLLVTHQLQFLEQADVIVIMDKGKISAMGTYESMAKSGLDFA 661
            |||.|.|.|||.:.:||.|..:.|:.||||::||..||:.::|..|:||..|.|..:..||.||.
plant    66 AVDAHTGSHLFKEALRGLLCSKSVIYVTHQVEFLPSADLTLVMKDGRISQAGKYNDILISGTDFR 130

  Fly   662 QML--TDPSKKDEGAGDA---PDKKSLSRQNSKLRDRHGSISSMES---AAESLAAESPMQ---T 715
            :::  ...|....|:.||   .:..:|..:|..:||..|.....||   ..:.|.:..|.:   .
plant   131 ELIGAHQESLAVVGSADASSVSENSALDEENGVVRDDIGFDGKQESQDLKNDKLDSGEPQRQFVQ 195

  Fly   716 QEGRVEGRIGMKLYKKYFGANGYGLFIVFAFFCIGAQVLASGGDIFLSYWVNKNGEAERDTFMAR 780
            :|.|.:|.:.:.:|.||. ...||..:| .|..:| |:|.....|..:||:              
plant   196 EEERAKGSVALDVYWKYI-TLAYGGALV-PFILLG-QILFQLLQIGSNYWM-------------- 243

  Fly   781 LRRAFPETRINADTD-PVDIYYFTGINVSVIIFS----LVRSMLFFYLAMRSSTTLHNTMFQGVT 840
               |: .|.|:.|.. ||.:.....:.|::...|    |||:.|......:::|.|.:.|...:.
plant   244 ---AW-ATPISEDVQAPVKLSTLMVVYVALAFGSSLCILVRATLLVTAGYKTATELFHKMHHCIF 304

  Fly   841 RAAMHF 846
            |:.|.|
plant   305 RSPMSF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4562NP_001262747.1 CFTR_protein 12..1300 CDD:273530 114/331 (34%)
ABC_membrane 98..367 CDD:294371
ABCC_MRP_domain1 443..643 CDD:213217 58/110 (53%)
ABC_membrane 799..1027 CDD:294371 12/52 (23%)
ABCC_MRP_domain2 1074..1295 CDD:213211
NAP5NP_177289.1 P-loop_NTPase <1..112 CDD:304359 58/110 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 99 1.000 Domainoid score I2369
eggNOG 1 0.900 - - E2759_KOG0054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138195at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.