DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4562 and TAP1

DIOPT Version :9

Sequence 1:NP_001262747.1 Gene:CG4562 / 42362 FlyBaseID:FBgn0038740 Length:1408 Species:Drosophila melanogaster
Sequence 2:NP_000584.3 Gene:TAP1 / 6890 HGNCID:43 Length:748 Species:Homo sapiens


Alignment Length:633 Identity:145/633 - (22%)
Similarity:269/633 - (42%) Gaps:100/633 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   734 GANGYGLFIVFAFFCIGAQ-----------VLASGGDIFLSY-------WVNKNGEAERDTFMAR 780
            |..|.|..:.....|:|::           ||:|.|::.:.:       |:.::|.|  |||...
Human   165 GQGGSGNPVRRLLGCLGSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSA--DTFTRN 227

  Fly   781 LRRAFPETRINADTDPVDIYYFTGINVSVIIFSLVRSMLFFYLAMRSSTTLHNTMFQGVTRAAMH 845
            |      |.::..|....:..|.|..:.......|.|            .|...:|..|.|....
Human   228 L------TLMSILTIASAVLEFVGDGIYNNTMGHVHS------------HLQGEVFGAVLRQETE 274

  Fly   846 FFNTNPSGRILNRFSKDLGQVDEILPSVMMDVMQIFLAIVGIVVVLCIINV--W-YILATVFLVI 907
            ||..|.:|.|::|.::|...:.:.|    .:.:.:||..  :|..||::.:  | .:..|:..:|
Human   275 FFQQNQTGNIMSRVTEDTSTLSDSL----SENLSLFLWY--LVRGLCLLGIMLWGSVSLTMVTLI 333

  Fly   908 VFYLLRVFYLSTSRDVKRLEAVTRSPIYSHLSASLNGLA---TIRAFG-----AQK--ELIAEFD 962
            ...||.:......:..:.||...|..:......::..|:   |:|:|.     |||  |.:.|..
Human   334 TLPLLFLLPKKVGKWYQLLEVQVRESLAKSSQVAIEALSAMPTVRSFANEEGEAQKFREKLQEIK 398

  Fly   963 NYQDMHSSGYYMFLATSRAFGYWLDCVCVVYIA--VITLSFFLFSPENGGDVGLAITQAMGMTGM 1025
            ......:..|.:...|:...|..|. |.::||.  ::|     ....:.|::...:...|..|..
Human   399 TLNQKEAVAYAVNSWTTSISGMLLK-VGILYIGGQLVT-----SGAVSSGNLVTFVLYQMQFTQA 457

  Fly  1026 VQWGMRQSAELENTMTAVERVVEYEDLEPEGDFESKPNKKPPKDWPE----DGKIVFDDLSLKYF 1086
            |:..:.....::..:.:.|::.||.|..|         :.||.....    :|.:.|.|:|..| 
Human   458 VEVLLSIYPRVQKAVGSSEKIFEYLDRTP---------RCPPSGLLTPLHLEGLVQFQDVSFAY- 512

  Fly  1087 PDKAADYVLRSLNIAIEGCEKVGIVGRTGAGKSSLINALFRLSYNE--GAILIDRRDTNDLGLHD 1149
            |::....||:.|...:...|...:||..|:|||: :.||.:..|..  |.:|:|.:.........
Human   513 PNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKST-VAALLQNLYQPTGGQLLLDGKPLPQYEHRY 576

  Fly  1150 LRSKISIIPQEPVLFSGTMRYNLDPFDEYSDAKLWESLEEVKLKQV-------VADLPSGLQSKI 1207
            |..:::.:.|||.:|..:::.|:    .|...:. .::||:....|       ::.||.|..:::
Human   577 LHRQVAAVGQEPQVFGRSLQENI----AYGLTQK-PTMEEITAAAVKSGAHSFISGLPQGYDTEV 636

  Fly  1208 SEGGTNFSVGQRQLVCLARAILRENRILVMDEATANVDPQTDALIQTTIRNKFK--DCTVLTIAH 1270
            .|.|:..|.||||.|.||||::|:..:|::|:||:.:|..:...::..:....:  ..:||.|..
Human   637 DEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQ 701

  Fly  1271 RLHTVMDSDKVLVMDAGKAVEFGSPFELLTTSEKK-VFHSMVKQTGDS 1317
            .|..|..:|.:|.::.|...|.|:..:|:   ||| .:.:||:...|:
Human   702 HLSLVEQADHILFLEGGAIREGGTHQQLM---EKKGCYWAMVQAPADA 746

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4562NP_001262747.1 CFTR_protein 12..1300 CDD:273530 139/613 (23%)
ABC_membrane 98..367 CDD:294371
ABCC_MRP_domain1 443..643 CDD:213217
ABC_membrane 799..1027 CDD:294371 49/242 (20%)
ABCC_MRP_domain2 1074..1295 CDD:213211 63/231 (27%)
TAP1NP_000584.3 3a01208 18..740 CDD:273363 142/625 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.