DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mrp5 and Abcc9

DIOPT Version :10

Sequence 1:NP_001262747.1 Gene:Mrp5 / 42362 FlyBaseID:FBgn0038740 Length:1408 Species:Drosophila melanogaster
Sequence 2:NP_035641.1 Gene:Abcc9 / 20928 MGIID:1352630 Length:1546 Species:Mus musculus


Alignment Length:53 Identity:14/53 - (26%)
Similarity:22/53 - (41%) Gaps:10/53 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 HSRSGAGDSGRSHPLTQIAY----LGSFT----IHFGAQIWMTFVSGLALYFS 89
            |.|:..|:  |.:...|...    .|:|.    ||.|.:::.....|.:||.|
Mouse    96 HMRTHTGE--RCYTCQQCGQRFYTTGNFAQHMRIHTGGRLYTCLQCGKSLYQS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mrp5NP_001262747.1 MRP_assoc_pro 79..1315 CDD:188098 4/11 (36%)
Abcc9NP_035641.1 MRP_assoc_pro 23..1543 CDD:188098 14/53 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 941..964
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.