DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4562 and LOC110439293

DIOPT Version :9

Sequence 1:	NP_001262747.1	Gene:	CG4562 / 42362	FlyBaseID:	FBgn0038740	Length:	1408	Species:	Drosophila melanogaster
Sequence 2:	XP_021330365.1	Gene:	LOC110439293 / 110439293	-ID:	-	Length:	174	Species:	Danio rerio

Alignment Length:	103	Identity:	25/103 - (24%)
Similarity:	39/103 - (37%)	Gaps:	32/103 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly   889 VVLCIINVWYILATVFLVIVFYLLRVFYLSTSRDVKRLEAVTRSPIYSHLSASLNGLATIRAFGA 953
            :.||:.:..: |.||:|::          ...||::.......|||       :..|..|.|.
Zfish    75 LALCLASFGF-LETVYLLV----------ERRRDIEHHMVFLLSPI-------IRSLTMILAM-- 119

  Fly   954 QKELIAEFDNYQDMHSSGYYMFLATSRAFGYW-LDCVC 990
               |:...:..:...||   |||     |.:| |..||
Zfish   120 ---LMIHLERLRGFRSS---MFL-----FLFWMLAVVC 146

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4562	NP_001262747.1	CFTR_protein	12..1300	CDD:273530	25/103 (24%)
		ABC_membrane	98..367	CDD:294371
		ABCC_MRP_domain1	443..643	CDD:213217
		ABC_membrane	799..1027	CDD:294371	25/103 (24%)
		ABCC_MRP_domain2	1074..1295	CDD:213211
LOC110439293	XP_021330365.1	SunT	5..>161	CDD:331423	25/103 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170586083
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930