DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4562 and hspa1b

DIOPT Version :9

Sequence 1:NP_001262747.1 Gene:CG4562 / 42362 FlyBaseID:FBgn0038740 Length:1408 Species:Drosophila melanogaster
Sequence 2:XP_002937685.2 Gene:hspa1b / 100485441 XenbaseID:XB-GENE-5915622 Length:643 Species:Xenopus tropicalis


Alignment Length:244 Identity:55/244 - (22%)
Similarity:91/244 - (37%) Gaps:80/244 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1055 EGDFESKPNKKPPKDWPEDGKIVFDDLSLKYF-------------PDKAADYVLRSLNIAIEGCE 1106
            :|.||.|..........||    ||:..:.:|             |:|.|   ||.|..|   ||
 Frog   215 DGIFEVKATAGDTHLGGED----FDNRMVNHFVEEFKRKHKKDISPNKRA---LRRLRTA---CE 269

  Fly  1107 KVGIVGRTGAGKSSLINALFRLSYNEGAILIDRRDTNDLGLHDLRSKISIIPQEPV---LFSGTM 1168
            :......:....|..|::||     ||.              |..:.|:....|.:   ||.|| 
 Frog   270 RAKRTLSSSTQASIEIDSLF-----EGI--------------DFYTSITRARFEELCADLFRGT- 314

  Fly  1169 RYNLDPFDE-YSDAKLWES-LEEV----------KLKQVVADLPSGLQSKISEGGTNFSVGQRQL 1221
               |:|.:: ..||||.:| :.|:          |:::::.|..:|.:       .|.|:...:.
 Frog   315 ---LEPVEKAMRDAKLDKSQIHEIVLVGGSTRIPKVQKLLQDFFNGKE-------LNKSINPDEA 369

  Fly  1222 VCLARAI--------LREN--RILVMDEATANVDPQTDALIQTTI--RN 1258
            |....|:        ..||  .:|::|.|..::..:|...:.|.:  ||
 Frog   370 VAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTVLIKRN 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4562NP_001262747.1 CFTR_protein 12..1300 CDD:273530 55/244 (23%)
ABC_membrane 98..367 CDD:294371
ABCC_MRP_domain1 443..643 CDD:213217
ABC_membrane 799..1027 CDD:294371
ABCC_MRP_domain2 1074..1295 CDD:213211 49/225 (22%)
hspa1bXP_002937685.2 PTZ00009 2..643 CDD:240227 55/244 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165170268
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.