DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4562 and qki

DIOPT Version :9

Sequence 1:NP_001262747.1 Gene:CG4562 / 42362 FlyBaseID:FBgn0038740 Length:1408 Species:Drosophila melanogaster
Sequence 2:XP_012818008.1 Gene:qki / 100038174 XenbaseID:XB-GENE-486525 Length:381 Species:Xenopus tropicalis


Alignment Length:281 Identity:57/281 - (20%)
Similarity:92/281 - (32%) Gaps:95/281 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 MINYVRTKE--------MNAIRNVNYIRGTLQSFIMFVTRISVFVSLVGFVLLGKLLTAEKAFVI 356
            |:..:.|||        :..:.|...:..:|.:|....|.            |.:||..|.:.|.
 Frog    25 MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFTH------------LERLLDEEISRVR 77

  Fly   357 TAYYNILRN-----TMTVYFPMGISQFAEL-------------------LVSIRRIQTFMLHEET 397
            ...||...|     ..|...|.||....:|                   ::..|.:....|..||
 Frog    78 KDMYNDTLNGSNNEKRTSELPDGIGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAET 142

  Fly   398 ----KVRDKSEDLDEQKLGKAGLIAEPTVAQTTGVLKPSSRRTSEAEHSIVISKLKAKWDQKNTD 458
                .||.|....|::|             ..|.:|:.|....::.|.    ::.|..|:..|.|
 Frog   143 GCKIMVRGKGSMRDKKK-------------AVTNILECSILALNKEEQ----NRGKPNWEHLNED 190

  Fly   459 ----NTLDN------ISLKFKPRQLVAVIGPVGSGKSSLIQAVLGELNPDSGSVKVNGT------ 507
                .|:::      |.||....::..::.|...|:.||.:..|.||      ..:|||      
 Frog   191 LHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMEL------AILNGTYRDANL 249

  Fly   508 --------LSYASQEPWLFTG 520
                    |:..:|.|.:.||
 Frog   250 KSPALAFSLAATAQAPRIITG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4562NP_001262747.1 CFTR_protein 12..1300 CDD:273530 57/281 (20%)
ABC_membrane 98..367 CDD:294371 16/79 (20%)
ABCC_MRP_domain1 443..643 CDD:213217 23/102 (23%)
ABC_membrane 799..1027 CDD:294371
ABCC_MRP_domain2 1074..1295 CDD:213211
qkiXP_012818008.1 STAR_dimer 34..92 CDD:293152 12/69 (17%)
SF1_like-KH 108..245 CDD:239088 31/159 (19%)
PRK04654 179..346 CDD:135173 23/98 (23%)
Quaking_NLS 354..381 CDD:293159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.