DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4686 and AT2G04900

DIOPT Version :9

Sequence 1:NP_001262744.1 Gene:CG4686 / 42361 FlyBaseID:FBgn0038739 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_565317.1 Gene:AT2G04900 / 815037 AraportID:AT2G04900 Length:128 Species:Arabidopsis thaliana


Alignment Length:108 Identity:34/108 - (31%)
Similarity:57/108 - (52%) Gaps:5/108 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RLAGIVGASAIFMGAYCKYVLKDVSDPKEQVDSQAFADVANRIHFLHSFAMMAMPLAHYPVFTGT 137
            ::|.|.|.:|:.:|.|..:|.|..:...:||     ...|:..|.:|:.|:::.|...||...|.
plant    25 KVAAISGMAALGLGTYGAHVFKPENPSYKQV-----WQTASLYHLVHTAALVSAPSTKYPNIFGG 84

  Fly   138 LMITGMMLFSGCMYYRALTGEKRLQPYATVGGFCLMAAWLSLV 180
            |:..|::.|||..|..||..:::....|..|||..:|||.:|:
plant    85 LLTAGIVAFSGTCYMVALREDRKFSTLAPFGGFAFIAAWATLL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4686NP_001262744.1 ribokinase_pfkB_like <24..114 CDD:294126 11/40 (28%)
DUF423 85..170 CDD:282144 24/84 (29%)
AT2G04900NP_565317.1 DUF423 37..116 CDD:398086 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I4692
eggNOG 1 0.900 - - E1_COG2363
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2534
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1632823at2759
OrthoFinder 1 1.000 - - FOG0005087
OrthoInspector 1 1.000 - - otm3199
orthoMCL 1 0.900 - - OOG6_102451
Panther 1 1.100 - - O PTHR43461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.920

Return to query results.
Submit another query.