DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4686 and tmem256

DIOPT Version :9

Sequence 1:NP_001262744.1 Gene:CG4686 / 42361 FlyBaseID:FBgn0038739 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001017620.1 Gene:tmem256 / 550283 ZFINID:ZDB-GENE-050417-92 Length:114 Species:Danio rerio


Alignment Length:111 Identity:36/111 - (32%)
Similarity:58/111 - (52%) Gaps:7/111 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RLAGIVGASAIFMGAYCKYVLK--DVSDPKEQVDSQAFADVANRIHFLHSFAMMAMPLAHYPVFT 135
            |:|||.||.|:..|||..:..:  :.||.:.::     .|.||:.||.||.|::.......|...
Zfish     9 RVAGISGALAVAAGAYGAHGFRRSEASDYQREL-----FDTANKYHFYHSLALLGAARCRKPALA 68

  Fly   136 GTLMITGMMLFSGCMYYRALTGEKRLQPYATVGGFCLMAAWLSLVL 181
            |.:::|||..|.|.:|::.||.:......|.:||..|:..|.::.|
Zfish    69 GVILLTGMGCFCGPLYHQPLTNDPSFSKLAPIGGSLLIVGWAAMAL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4686NP_001262744.1 ribokinase_pfkB_like <24..114 CDD:294126 14/42 (33%)
DUF423 85..170 CDD:282144 25/86 (29%)
tmem256NP_001017620.1 DUF423 21..103 CDD:282144 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595683
Domainoid 1 1.000 50 1.000 Domainoid score I11703
eggNOG 1 0.900 - - E1_COG2363
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5334
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1632823at2759
OrthoFinder 1 1.000 - - FOG0005087
OrthoInspector 1 1.000 - - otm26361
orthoMCL 1 0.900 - - OOG6_102451
Panther 1 1.100 - - O PTHR43461
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4384
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.920

Return to query results.
Submit another query.