powered by:
Protein Alignment CG4686 and CG7328
DIOPT Version :9
Sequence 1: | NP_001262744.1 |
Gene: | CG4686 / 42361 |
FlyBaseID: | FBgn0038739 |
Length: | 181 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_649181.1 |
Gene: | CG7328 / 40204 |
FlyBaseID: | FBgn0036942 |
Length: | 306 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 17/67 - (25%) |
Similarity: | 28/67 - (41%) |
Gaps: | 10/67 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 SHGSLYRLAGCHYHFIRLAGIVGASAIFMGAYCKYVLKDVSDPKEQVDSQAFADVANRI--HFLH 119
::|:.|.::. |...::...:||...||..:....||......|.| |.|||: |.:.
Fly 236 ANGNYYEMSS--YKQDKVVDTLGAGDSFMAGFIYATLKARRSLAEAV------DFANRVASHKIT 292
Fly 120 SF 121
.|
Fly 293 GF 294
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45456431 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.