powered by:
Protein Alignment CG4686 and CG17010
DIOPT Version :9
Sequence 1: | NP_001262744.1 |
Gene: | CG4686 / 42361 |
FlyBaseID: | FBgn0038739 |
Length: | 181 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_609560.2 |
Gene: | CG17010 / 34650 |
FlyBaseID: | FBgn0032424 |
Length: | 429 |
Species: | Drosophila melanogaster |
Alignment Length: | 53 |
Identity: | 14/53 - (26%) |
Similarity: | 21/53 - (39%) |
Gaps: | 11/53 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 74 LAGIVGASAIFMGAYCKYVLKDVSDPKEQVDSQAFADVANRIHFLHSFAMMAM 126
||...||...|||:...::.: .||...: :.|...||.|..:|
Fly 250 LADPSGAGDAFMGSLAYHIAR---FPKLSTE--------HHISAAHSCAAYSM 291
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45456440 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.