DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4686 and CG17010

DIOPT Version :9

Sequence 1:NP_001262744.1 Gene:CG4686 / 42361 FlyBaseID:FBgn0038739 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_609560.2 Gene:CG17010 / 34650 FlyBaseID:FBgn0032424 Length:429 Species:Drosophila melanogaster


Alignment Length:53 Identity:14/53 - (26%)
Similarity:21/53 - (39%) Gaps:11/53 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LAGIVGASAIFMGAYCKYVLKDVSDPKEQVDSQAFADVANRIHFLHSFAMMAM 126
            ||...||...|||:...::.:   .||...:        :.|...||.|..:|
  Fly   250 LADPSGAGDAFMGSLAYHIAR---FPKLSTE--------HHISAAHSCAAYSM 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4686NP_001262744.1 ribokinase_pfkB_like <24..114 CDD:294126 9/39 (23%)
DUF423 85..170 CDD:282144 9/42 (21%)
CG17010NP_609560.2 ribokinase 6..301 CDD:238579 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456440
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.