DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4686 and Tmem256

DIOPT Version :9

Sequence 1:NP_001262744.1 Gene:CG4686 / 42361 FlyBaseID:FBgn0038739 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001164020.1 Gene:Tmem256 / 287442 RGDID:1563438 Length:113 Species:Rattus norvegicus


Alignment Length:116 Identity:41/116 - (35%)
Similarity:61/116 - (52%) Gaps:5/116 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LAGCHYHFIRLAGIVGASAIFMGAYCKYVLKDVSDPKEQVDSQAFADVANRIHFLHSFAMMAMPL 128
            :||....|.||..:.||.|:.:..|..:   ....| :....:.| |.||:.|||||.|::.:|.
  Rat     1 MAGVGAAFRRLGALSGAGALSLATYGAH---GAQFP-DAYGKELF-DKANKHHFLHSLALLGVPY 60

  Fly   129 AHYPVFTGTLMITGMMLFSGCMYYRALTGEKRLQPYATVGGFCLMAAWLSL 179
            ...||:.|.|:.:|..||....||:||:|:..:|....|||..|:..||:|
  Rat    61 CRKPVWAGLLLASGTTLFCTSFYYQALSGDTSIQTLGPVGGSLLILGWLAL 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4686NP_001262744.1 ribokinase_pfkB_like <24..114 CDD:294126 13/49 (27%)
DUF423 85..170 CDD:282144 28/84 (33%)
Tmem256NP_001164020.1 DUF423 22..101 CDD:398086 27/83 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353552
Domainoid 1 1.000 58 1.000 Domainoid score I10518
eggNOG 1 0.900 - - E1_COG2363
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5191
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1632823at2759
OrthoFinder 1 1.000 - - FOG0005087
OrthoInspector 1 1.000 - - otm44975
orthoMCL 1 0.900 - - OOG6_102451
Panther 1 1.100 - - O PTHR43461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.