DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4686 and Y106G6H.8

DIOPT Version :9

Sequence 1:NP_001262744.1 Gene:CG4686 / 42361 FlyBaseID:FBgn0038739 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001379268.1 Gene:Y106G6H.8 / 190926 WormBaseID:WBGene00013720 Length:156 Species:Caenorhabditis elegans


Alignment Length:110 Identity:44/110 - (40%)
Similarity:66/110 - (60%) Gaps:2/110 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IRLAGIVGASAIFMGAYCKYVLKDVSDPKEQVDSQAFADVANRIHFLHSFAMMAMPLAHYPVFTG 136
            |||||:.||.||.:|||..:||:|  :|......:...|.|:|.|.:||.|::|.|.|.:|:.|.
 Worm    49 IRLAGLSGAVAISLGAYGSHVLRD--NPSIDERRRTAFDTASRYHLIHSLALLASPAARFPLVTA 111

  Fly   137 TLMITGMMLFSGCMYYRALTGEKRLQPYATVGGFCLMAAWLSLVL 181
            .|...|:.||.|..|:.:::|.:..:.|..:||..|:.||||.:|
 Worm   112 GLFTAGITLFCGPCYHYSISGVETTRKYTPIGGVTLIIAWLSFIL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4686NP_001262744.1 ribokinase_pfkB_like <24..114 CDD:294126 18/41 (44%)
DUF423 85..170 CDD:282144 28/84 (33%)
Y106G6H.8NP_001379268.1 DUF423 62..144 CDD:398086 27/83 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167098
Domainoid 1 1.000 60 1.000 Domainoid score I7009
eggNOG 1 0.900 - - E1_COG2363
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H136232
Inparanoid 1 1.050 87 1.000 Inparanoid score I3712
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29218
OrthoDB 1 1.010 - - D1632823at2759
OrthoFinder 1 1.000 - - FOG0005087
OrthoInspector 1 1.000 - - otm14650
orthoMCL 1 0.900 - - OOG6_102451
Panther 1 1.100 - - O PTHR43461
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4384
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.890

Return to query results.
Submit another query.