DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4572 and scpl41

DIOPT Version :9

Sequence 1:NP_650836.1 Gene:CG4572 / 42360 FlyBaseID:FBgn0038738 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001318730.1 Gene:scpl41 / 834228 AraportID:AT5G42230 Length:469 Species:Arabidopsis thaliana


Alignment Length:453 Identity:115/453 - (25%)
Similarity:199/453 - (43%) Gaps:88/453 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EVQKLARVVGSQFHGVESYSGYLTVDPGFKSNMFFWYFPAEQEPEYAPVVLWLQGGPGASSL-FG 132
            |...:.|:.|........|:||:.:|.....::|:::..||:.|:..|:.|||.||||.||: .|
plant    25 ETDLVVRLPGQPKVVFRQYAGYVDLDLNAGRSLFYYFVEAEKHPDTKPLTLWLNGGPGCSSVGGG 89

  Fly   133 LFTENGPLELDGHGK-LQKRNYTWSKTHNLIYIDNPVGTGFSFTENDAGYATNEKDVGRNLHEAV 196
            .|||.||....|:|: |:..:.:|:|..||:::|:|.|.|:|::...:.|...:|....::...:
plant    90 AFTELGPFYPTGYGRGLRINSMSWNKASNLLFVDSPAGVGWSYSNRSSDYNAGDKSAASDMLVFL 154

  Fly   197 MQLYELFEWSNSSGFWVTGESYAGKYVPALAYHIHKVQNAIETRVYVPLKGVAIGNGLSDPLHQL 261
            ::.::.|....|...::|||||||.|:|.||..|.. .|:..:.....:||:||||    ||.:|
plant   155 LRWFDKFPELKSHDLFLTGESYAGHYIPQLADAILS-YNSRSSGFKFNIKGIAIGN----PLLKL 214

  Fly   262 KYG-----DYLYQLGLIDEHGLQSFHDAEAKGAECIKSHDMECAF------------DVFDSLIN 309
            ...     ::.:..|:|          :|..|    ::..::|.|            |..:..|.
plant   215 DRDIPAVYEFFWSHGMI----------SEVVG----RTIKIQCDFSHYTYAYPHNVSDACNDAIR 265

  Fly   310 --GDLTNGSLFSNLTGYNWYYNYLKTHD------DDGANLGEF-LQAGATRRAIHVG-----NKT 360
              ||:|.              .|:.|.|      .....|.|. |:..||:.::.|.     .:.
plant   266 EAGDITT--------------EYVNTFDVLPDLCYPSIALQELRLKQMATKMSMGVDVCMNYERQ 316

  Fly   361 FHDLDKENKVELHLKK-------------------DIMDSVAPWIAELLAH-YTVCIYSGQLDII 405
            |:....|.::.||..:                   |:..::.|.:..::.: ..|.|:||..|.:
plant   317 FYLNIPEVQMALHANRTNLPYSWSLCSNLLNYSAIDVNTNMLPTLKRIIQNKIPVRIFSGDQDSV 381

  Fly   406 VAYPLTRNYLNQLKFPGSDKYKVAPREVWRVGKEVAGYVKHAGHLVEI-MVRNAGHMAPHDQP 467
            |.:..||..:.:|....:.|..| |..||...::|.|:....|:|:.. .||.|.|...:.||
plant   382 VPFLGTRTIVGELANDLNFKTTV-PYGVWFHKRQVGGWAIEYGNLLTFATVRGAAHAVAYTQP 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4572NP_650836.1 Peptidase_S10 83..479 CDD:298660 112/439 (26%)
scpl41NP_001318730.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54069
OrthoDB 1 1.010 - - D625787at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.