DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4572 and scpl39

DIOPT Version :9

Sequence 1:NP_650836.1 Gene:CG4572 / 42360 FlyBaseID:FBgn0038738 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_190770.1 Gene:scpl39 / 824365 AraportID:AT3G52020 Length:501 Species:Arabidopsis thaliana


Alignment Length:468 Identity:120/468 - (25%)
Similarity:198/468 - (42%) Gaps:88/468 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NNASMSKQEVQK---LARVVGSQFHGVESYSGYLTVDPGFKSNMFFWYFPAEQEPEYAPVVLWLQ 122
            |.:.:::||.::   :..:.|........|.||:||:.....::::::..|.:..:..|:||||.
plant    65 NTSGVNQQEQKERDLIENLPGQPSVSFRQYGGYVTVNESAGRSLYYYFVEATKTKKSLPLVLWLN 129

  Fly   123 GGPGASSLFGLFTENGPLELDGHGK-LQKRNYTWSKTHNLIYIDNPVGTGFSFTENDAGYAT-NE 185
            ||||.|||:|.|.|.||..:.|.|| |....|:|:...|::::::|||||||:|..::.... .:
plant   130 GGPGCSSLYGAFQELGPFRIYGDGKTLYTNPYSWNNVANILFLESPVGTGFSYTNTESDLENPGD 194

  Fly   186 KDVGRNLHEAVMQLYELFEWSNSSGFWVTGESYAGKYVPALAYHI---HKVQNAIETRVYVPLKG 247
            .....:.:..:::..|.|.......|::.||||||.|||.||..|   :|.||      ::.|:|
plant   195 MKAAADKYIFLVKWLERFPEYKGREFYIAGESYAGHYVPQLAQTILVHNKNQN------FINLRG 253

  Fly   248 VAIGN-GLSDPLHQLKYGDYLYQLGLIDEHGLQSFH-----DAEAKGAECIKSHDMECAFDVFDS 306
            :.||| .|:|.:......|||....|:.:..|.|:.     |......:||          ....
plant   254 ILIGNPTLNDIVETTGSFDYLVSHALLSQDSLLSYKENCATDTPKMEVDCI----------ALSM 308

  Fly   307 LINGDLTNGSLFSNLT---------------------------GYNWYYNYLKTHDDDGANLGEF 344
            .|:.|:...:|::.||                           |..:...||...|         
plant   309 KIDDDIKKMNLYNILTPTCINATLTPLTNQSKECTTVLQYEPCGMQYIAAYLNRED--------- 364

  Fly   345 LQAGATRRAIHVGNKTFHD--LDKENKVELHLKKDIMDSVAPWIAELLAH--YTVCIYSGQLDII 405
                 .:|::|| .|..|.  |..|.......:.|...|:.|.:.||:.|  ..|.:|:|..|.:
plant   365 -----VQRSMHV-TKLPHTWMLCNEATGFNWNQTDYSASMLPILKELMKHDQLRVWVYTGDTDTV 423

  Fly   406 VAYPLTRNYLNQLKFPGSDKYKVAPREVWRVGKEVAGYV-KHAGHLVEIMVRNAGHMAPHDQPKW 469
            :...:|.:.|..:....     |.....|....:|.|:. ::.|:.....|..|||..|..:|| 
plant   424 IPLTVTMHALKMMNLTA-----VTDWLPWFSEGQVGGFTEEYKGNFRYATVIGAGHEVPLYKPK- 482

  Fly   470 LYMMIDHLTHYKH 482
                 ..||.:||
plant   483 -----AALTLFKH 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4572NP_650836.1 Peptidase_S10 83..479 CDD:298660 113/438 (26%)
scpl39NP_190770.1 Peptidase_S10 84..494 CDD:278857 117/449 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54069
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.