DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4572 and SCPL51

DIOPT Version :9

Sequence 1:NP_650836.1 Gene:CG4572 / 42360 FlyBaseID:FBgn0038738 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_565663.1 Gene:SCPL51 / 817336 AraportID:AT2G27920 Length:461 Species:Arabidopsis thaliana


Alignment Length:457 Identity:124/457 - (27%)
Similarity:217/457 - (47%) Gaps:73/457 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KLARVVGSQFHGVESYSGYLTVDPGFKSNMFFWYFPA----EQEPEYAPVVLWLQGGPGASSL-F 131
            |..|.:.|.  |.|:: ||:.|.|  |::||:|::.:    |...:..|::||||||||||.: .
plant    23 KHVRKINSD--GSEAW-GYVEVRP--KAHMFWWHYKSPYRVENPSKPWPIILWLQGGPGASGVGI 82

  Fly   132 GLFTENGPLELDGHGKLQKRNYTWSKTHNLIYIDNPVGTGFSFTENDAG--YATNEKDVGRNLHE 194
            |.|.|.|||:.    .|:.||.||.|..:|:::|:|||.|:||.|.:..  |..::::..::|.:
plant    83 GNFQEVGPLDT----FLKPRNSTWLKKADLLFVDSPVGAGYSFVEGNQKDLYVKSDEEAAQDLTK 143

  Fly   195 AVMQLYELFEWSNSSGFWVTGESYAGKYVPALAYHIHKVQNAIET-RVYVPLKGVAIGNG-LSDP 257
            .:.||:...:..|.|..::..|||.||....|..   .|.:|::: ::.:.|.||.:|:. :|..
plant   144 LLQQLFNKNQTLNQSPLFIVAESYGGKIAVKLGL---SVIDAVQSGKLKLHLGGVILGDSWISPE 205

  Fly   258 LHQLKYGDYLYQLGLIDEHGLQSFHDAEAKGAECIKSH--------------DMECAF------- 301
            .....:|..|..:..:|::||.|.:..    ||.||:.              |:|...       
plant   206 DFVFSWGPLLKHVSRLDDNGLDSSNSL----AEKIKTQIKNGEYVGATQTWMDLENLISSKSNFV 266

  Fly   302 DVFDSLINGDLTNGSLFSNL--------TGYNWYYNYLKTHDDDGANLGEF--LQAGATRRAIHV 356
            |.::.|::..:...||.::|        ..|:.|.|.:::..|.....|:.  |..|..::.:.:
plant   267 DFYNFLLDTGMDPVSLTTSLKIKKEEKIKKYSRYLNDMRSLSDVEDVEGDLDKLMNGVIKKKLKI 331

  Fly   357 -------GNKTFHDLDKENKVELHLKKDIMDSVAPWIAELLA-HYTVCIYSGQLDIIVAYPLTRN 413
                   ||.:.   |....:|....|.:::.|    .|||| ...|.||:||||:|.:...|..
plant   332 IPNDLIWGNNSD---DVFTAMEAAFMKPVIEDV----DELLATGVDVTIYNGQLDVICSTSGTEA 389

  Fly   414 YLNQLKFPGSDKYKVAPRE--VWRVGKEVAGYVKHAGHLVEIMVRNAGHMAPHDQPKWLYMMIDH 476
            ::::|::.|.:::|...||  .....:...|:.|...:|....:..|||..|.|:|.....|:..
plant   390 WVHKLRWEGLEEFKKMEREPLFCESDRATRGFTKSYKNLHFYWILGAGHFVPVDEPCVALKMVGE 454

  Fly   477 LT 478
            :|
plant   455 IT 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4572NP_650836.1 Peptidase_S10 83..479 CDD:298660 121/446 (27%)
SCPL51NP_565663.1 Peptidase_S10 36..452 CDD:298660 117/436 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54069
OrthoDB 1 1.010 - - D625787at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.