DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4572 and Scpep1

DIOPT Version :9

Sequence 1:NP_650836.1 Gene:CG4572 / 42360 FlyBaseID:FBgn0038738 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_083299.3 Gene:Scpep1 / 74617 MGIID:1921867 Length:452 Species:Mus musculus


Alignment Length:438 Identity:121/438 - (27%)
Similarity:191/438 - (43%) Gaps:79/438 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 YLTVDPGFKSNMFFWYF----PAEQEPEYAPVVLWLQGGPGASSL-FGLFTENGPLELDGHGKLQ 149
            |:||..  .::||:|.:    |.:...| .|:|:|||||||.||. ||.|.|.|||:.    :|:
Mouse    42 YVTVRK--DAHMFWWLYYATNPCKNFSE-LPLVMWLQGGPGGSSTGFGNFEEIGPLDT----QLK 99

  Fly   150 KRNYTWSKTHNLIYIDNPVGTGFSFTENDAGYATNEKDVGRNLHEAVMQLYELFEWSNSSGFWVT 214
            .||.||.:..:|:::|||||||||:......||.:...|..::...:...::..:...:..|::.
Mouse   100 PRNTTWLQWASLLFVDNPVGTGFSYVNTTDAYAKDLDTVASDMMVLLKSFFDCHKEFQTVPFYIF 164

  Fly   215 GESYAGKYVPALAYHIHKV--QNAIETRVYVPLKGVAIGNGLSDPLHQ-LKYGDYLYQLGLIDEH 276
            .|||.||....::..::|.  |..|:..    ..|||:|:....|:.. |.:|.|||.:.|:|..
Mouse   165 SESYGGKMAAGISVELYKAVQQGTIKCN----FSGVALGDSWISPVDSVLSWGPYLYSMSLLDNQ 225

  Fly   277 GLQSFHDAEAKGAECIKSHDMECAFDVFDSLINGDLTNGS---------LFSNLTGYNWYYNYLK 332
            ||....|               .|..|.|::..|.....:         :..|..|.| :||.|.
Mouse   226 GLAEVSD---------------IAEQVLDAVNKGFYKEATQLWGKAEMIIEKNTDGVN-FYNILT 274

  Fly   333 THDDDGA--NLGEFLQAG----ATRRAIHVGNKTFHDL-----DKENK--------------VEL 372
            ....:.|  :..|||::.    ..|...|:.......|     .|:.|              |.|
Mouse   275 KSSPEKAMESSLEFLRSPLVRLCQRHVRHLQGDALSQLMNGPIKKKLKIIPEDISWGAQASYVFL 339

  Fly   373 HLKKDIMDSVAPWIAELL-AHYTVCIYSGQLDIIVAYPLTRNYLNQLKFPGSDKYKVAPREVWRV 436
            .::.|.|......:.:|| |...|.:|:||||:||......:::.:||:|...|:.   :..|:.
Mouse   340 SMEGDFMKPAIDVVDKLLAAGVNVTVYNGQLDLIVDTIGQESWVQKLKWPQLSKFN---QLKWKA 401

  Fly   437 ------GKEVAGYVKHAGHLVEIMVRNAGHMAPHDQPKWLYMMIDHLT 478
                  ..|.|.:||...:|....:..||||.|.||.:....|:..:|
Mouse   402 LYTDPKSSETAAFVKSYENLAFYWILKAGHMVPSDQGEMALKMMKLVT 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4572NP_650836.1 Peptidase_S10 83..479 CDD:298660 121/438 (28%)
Scpep1NP_083299.3 Peptidase_S10 34..451 CDD:278857 121/438 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54069
OrthoDB 1 1.010 - - D274674at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R172
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.