DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4572 and CTSA

DIOPT Version :9

Sequence 1:NP_650836.1 Gene:CG4572 / 42360 FlyBaseID:FBgn0038738 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001161066.1 Gene:CTSA / 5476 HGNCID:9251 Length:481 Species:Homo sapiens


Alignment Length:507 Identity:136/507 - (26%)
Similarity:230/507 - (45%) Gaps:127/507 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PGE--------------PLFLTPLI----------NNASMSKQEVQKLARVVGSQFHGVESYSGY 90
            |||              ||||..|:          ..|:..:.|:|:|..:  ::......||||
Human     9 PGEQGRGGAEMIRAAPPPLFLLLLLLLLLVSWASRGEAAPDQDEIQRLPGL--AKQPSFRQYSGY 71

  Fly    91 LTVDPGFKSNMFFWYFPAEQEPEYAPVVLWLQGGPGASSLFGLFTENGPLELDGHGKLQKRNYTW 155
            |. ..|.| ::.:|:..::::||.:||||||.||||.|||.||.||:||..:             
Human    72 LK-GSGSK-HLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLI------------- 121

  Fly   156 SKTHNLIYIDNPVGTGFSFTENDAGYATNEKDVGRNLHEAVMQLYELF-EWSNSSGFWVTGESYA 219
               .|::|:::|.|.|||::: |..||||:.:|.::..||:...:.|| |:.|:..| :||||||
Human   122 ---ANVLYLESPAGVGFSYSD-DKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLF-LTGESYA 181

  Fly   220 GKYVPALAYHIHKVQNAIETRVYVPLKGVAIGNGLS-----DPLHQLKYGDYLYQLGLIDEH--- 276
            |.|:|.||..:.:..:       :.|:|:|:|||||     |  :.|.|  :.|..||:...   
Human   182 GIYIPTLAVLVMQDPS-------MNLQGLAVGNGLSSYEQND--NSLVY--FAYYHGLLGNRLWS 235

  Fly   277 GLQSFHDAEAKGAECIKSHDMECA-----------------FDVF---------------DSLIN 309
            .||: |...........:.|:||.                 ::::               |:::.
Human   236 SLQT-HCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVV 299

  Fly   310 GDLTNGSLFSNL-TGYNWYYNYLKTHD--------DDGANLGEFLQAGATRRAIHVGNKTFHDLD 365
            .||  |::|:.| ....|:...|::.|        .:......:|.....|:|:::..: ....|
Human   300 QDL--GNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQ-LPQWD 361

  Fly   366 KEN-KVELHLKKDIMDSVAPWIAELLA--HYTVCIYSGQLDIIVAYPLTRNYLNQLKFPGSDKYK 427
            ..| .|.|..:: :..|:.....:||:  .|.:.:|:|.:|      :..|::....|..|...|
Human   362 MCNFLVNLQYRR-LYRSMNSQYLKLLSSQKYQILLYNGDVD------MACNFMGDEWFVDSLNQK 419

  Fly   428 V-APREVWRV-----GKEVAGYVKHAGHLVEIMVRNAGHMAPHDQPKWLYMM 473
            : ..|..|.|     |:::||:||...|:..:.::.||||.|.|:|...:.|
Human   420 MEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTM 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4572NP_650836.1 Peptidase_S10 83..479 CDD:298660 124/450 (28%)
CTSANP_001161066.1 Peptidase_S10 57..477 CDD:278857 124/459 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2160
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100109
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R172
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.