DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4572 and Ctsa

DIOPT Version :9

Sequence 1:NP_650836.1 Gene:CG4572 / 42360 FlyBaseID:FBgn0038738 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001011959.2 Gene:Ctsa / 296370 RGDID:1309070 Length:493 Species:Rattus norvegicus


Alignment Length:520 Identity:141/520 - (27%)
Similarity:234/520 - (45%) Gaps:104/520 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SGAKGVEGERPYRRSFINPYPRYQFFDDGVDPGEPLFLTPLI-----NNASMSKQEVQKLARVVG 78
            |..|...||:.::.:   ..||...        .||.|..|:     :.|:..:.|:..|..:  
  Rat     3 SSPKAAPGEQGHKEA---EMPRAAL--------SPLLLLLLLSWASRDEAAPDQDEIDCLPGL-- 54

  Fly    79 SQFHGVESYSGYLTVDPGFKSNMFFWYFPAEQEPEYAPVVLWLQGGPGASSLFGLFTENGPLELD 143
            ::......|||||....  ..:..:|:..::.:|:.:||||||.||||.|||.||.||:||..:.
  Rat    55 AKQPSFRQYSGYLKASD--SKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQ 117

  Fly   144 GHG-KLQKRNYTWSKTHNLIYIDNPVGTGFSFTENDAGYATNEKDVGRNLHEAVMQLYELFEWSN 207
            ..| .|:...|:|:...|::||::|.|.|||::: |..|.||:.:|..|.::|:...|.||....
  Rat   118 PDGVTLEYNPYSWNLIANMLYIESPAGVGFSYSD-DKMYVTNDTEVAENNYQALKDFYHLFPEYK 181

  Fly   208 SSGFWVTGESYAGKYVPALAYHIHKVQNAIETRVYVPLKGVAIGNGLS-----DPLHQLKYGDYL 267
            .:..::|||||||.|:|.||..:.:..:       :.|:|:|:|||||     |  :.|.|  :.
  Rat   182 DNKLFLTGESYAGIYIPTLAVLVMQDPS-------MNLQGLAVGNGLSSYEQND--NSLVY--FA 235

  Fly   268 YQLGLIDEH---GLQ---------SFHDAEAKGAECIKSHD-----------------MECAFDV 303
            |..||:...   .||         :|:|  .|..:|:.:..                 ..||..|
  Rat   236 YYHGLLGNRLWTSLQTHCCSQNKCNFYD--NKDPDCVNNLQEVSRIVGKSGLNIYNLYAPCAGGV 298

  Fly   304 ------FDSLINGDLTNGSLFSNLTGYNWYYNYLKTHDDDGANL----------GEFLQAGATRR 352
                  .|:|:..|.  |::|:.|.....:...|.....|...|          ..:|.....|:
  Rat   299 PGRDRSEDTLVVQDF--GNIFTRLPLKRRFPEALLLRSGDKVRLDPPCTNTTAPSTYLNNPYVRK 361

  Fly   353 AIHVGNKTFHDLDKEN-KVELHLKKDIMDSVAPWIAELLA--HYTVCIYSGQLDIIVAYPLTRNY 414
            |:|: .::....|..| .|.|..:: :.:|:.....:||:  .|.:.:|:|.:|      :..|:
  Rat   362 ALHI-PESLPRWDMCNLMVNLQYRR-LYESMNSQYLKLLSSQKYQILLYNGDVD------MACNF 418

  Fly   415 LNQLKFPGSDKYKV-APREVWRV-----GKEVAGYVKHAGHLVEIMVRNAGHMAPHDQPKWLYMM 473
            :....|..|...|: ..|..|.|     |::|||:||...|:..:.::.||||.|.|:|:..:.|
  Rat   419 MGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTM 483

  Fly   474  473
              Rat   484  483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4572NP_650836.1 Peptidase_S10 83..479 CDD:298660 128/451 (28%)
CtsaNP_001011959.2 Peptidase_S10 52..489 CDD:278857 128/460 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100109
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.