DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4572 and Scpep1

DIOPT Version :9

Sequence 1:NP_650836.1 Gene:CG4572 / 42360 FlyBaseID:FBgn0038738 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_017452440.1 Gene:Scpep1 / 114861 RGDID:620067 Length:461 Species:Rattus norvegicus


Alignment Length:432 Identity:115/432 - (26%)
Similarity:184/432 - (42%) Gaps:91/432 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 YLTVDPGFKSNMFFWYF----PAEQEPEYAPVVLWLQGGPGASSL-FGLFTENGPLELDGHGKLQ 149
            |:||..  .:.||:|.:    |.:...| .|:|:|||||||.||. ||.|.|.|||:.    :|:
  Rat    51 YVTVRE--DARMFWWLYYATNPCKNFSE-LPLVMWLQGGPGGSSTGFGNFEEIGPLDT----RLK 108

  Fly   150 KRNYTWSKTHNLIYIDNPVGTGFSFTENDAGYATNEKDVGRNLHEAVMQLYELFEWSNSSGFWVT 214
            .||.||.:..:|:::|||||||||:......||.:...|..::...:...::..:...:..|::.
  Rat   109 PRNTTWLQWASLLFVDNPVGTGFSYVNTTDAYAKDLDTVASDMMVLLKSFFDCHKEFQTVPFYIF 173

  Fly   215 GESYAGKYVPALAYHIHKV--QNAIETRVYVPLKGVAIGNGLSDPLHQ-LKYGDYLYQLGLIDEH 276
            .|||.||....::..:||.  |..|:..    ..|||:|:....|:.. |.:|.|||.:.|:|..
  Rat   174 SESYGGKMAAGISLELHKAIQQGTIKCN----FSGVALGDSWISPVDSVLSWGPYLYSVSLLDNK 234

  Fly   277 GLQSFHDAEAKGAECIKSHDMECAFDVFDSLINGDLTNGSLF---------------SNLTGYNW 326
            ||     ||..              |:.:.::|.  .|...:               .|..|.| 
  Rat   235 GL-----AEVS--------------DIAEQVLNA--VNKGFYKEATQLWGKAEMIIEKNTDGVN- 277

  Fly   327 YYNYL--KTHDDDGANLGEFLQAG----ATRRAIHVGNKTFHDL-------------------DK 366
            :||.|  .|.|....:..||.::.    ..|...|:.......|                   .:
  Rat   278 FYNILTKSTPDTSMESSLEFFRSPLVRLCQRHVRHLQGDALSQLMNGPIKKKLKIIPDDVSWGAQ 342

  Fly   367 ENKVELHLKKDIMDSVAPWIAELL-AHYTVCIYSGQLDIIVAYPLTRNYLNQLKFPGSDKYKVAP 430
            .:.|.:.:::|.|..|...:..|| ....|.:|:||||:||......:::.:||:|...::.   
  Rat   343 SSSVFISMEEDFMKPVIDIVDTLLELGVNVTVYNGQLDLIVDTIGQESWVQKLKWPQLSRFN--- 404

  Fly   431 REVWRV------GKEVAGYVKHAGHLVEIMVRNAGHMAPHDQ 466
            :..|:.      ..|.:.:||...:|....:..||||.|.||
  Rat   405 QLKWKALYTNPKSSETSAFVKSYENLAFYWILKAGHMVPADQ 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4572NP_650836.1 Peptidase_S10 83..479 CDD:298660 115/432 (27%)
Scpep1XP_017452440.1 Peptidase_S10 46..455 CDD:395361 115/432 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54069
OrthoDB 1 1.010 - - D274674at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.